The Context.dev MCP connector routes your AI agent's tool calls to Context.dev's own MCP server through Scalekit. Each user signs in to Context.dev once, and Scalekit stores and refreshes their tokens, so your agent never handles credentials. It comes with 40 tools.
- Tools
- 40
- What they doRead · write · destructive
- 28 · 5 · 728 read5 write7 destructive
- Users sign in with
- OAuth
- OAuth app
- Your own Context.dev MCP server app
Setup
Install the SDK
Terminal window npm install @scalekit-sdk/node dotenvTerminal window pip install scalekit-sdk-python python-dotenvSet your credentials
Add your Scalekit credentials to your
.envfile. Find values in app.scalekit.com > Developers > API Credentials..env SCALEKIT_ENVIRONMENT_URL=<your-environment-url>SCALEKIT_CLIENT_ID=<your-client-id>SCALEKIT_CLIENT_SECRET=<your-client-secret>Create the Context.dev MCP connection
In AgentKit > Connections, create a Context.dev MCP connection and copy its redirect URI. The name you give it is the
connection_nameyour code passes. See Configure connections.Register an OAuth app
Context.dev MCP server connections use your own OAuth app. Register one with Context.dev MCP server and add the redirect URI you copied.
Then enter the app's Client ID and Client Secret on the Context.dev MCP connection.
Authorize a user and make your first call
quickstart.mts import { ScalekitClient } from '@scalekit-sdk/node'import 'dotenv/config'import { createInterface } from 'node:readline/promises'const scalekit = new ScalekitClient(process.env.SCALEKIT_ENVIRONMENT_URL,process.env.SCALEKIT_CLIENT_ID,process.env.SCALEKIT_CLIENT_SECRET,)const actions = scalekit.actionsconst connector = 'contextdevmcp'const identifier = 'user_123'// Generate an authorization link for the userconst { link } = await actions.getAuthorizationLink({ connectionName: connector, identifier })console.log('Authorize Context.dev MCP:', link)const rl = createInterface({ input: process.stdin, output: process.stdout })await rl.question('Press Enter after authorizing...')rl.close()// Make your first callconst result = await actions.executeTool({connector,identifier,toolName: 'contextdevmcp_get_monitor_limits',toolInput: {},})console.log(result)Terminal window npx tsx quickstart.mtsquickstart.py import osfrom scalekit import ScalekitClientfrom dotenv import load_dotenvload_dotenv()scalekit_client = ScalekitClient(env_url=os.getenv("SCALEKIT_ENVIRONMENT_URL"),client_id=os.getenv("SCALEKIT_CLIENT_ID"),client_secret=os.getenv("SCALEKIT_CLIENT_SECRET"),)actions = scalekit_client.actionsconnection_name = "contextdevmcp"identifier = "user_123"# Generate an authorization link for the userlink_response = actions.get_authorization_link(connection_name=connection_name,identifier=identifier,)print("Authorize Context.dev MCP:", link_response.link)input("Press Enter after authorizing...")# Make your first callresult = actions.execute_tool(tool_input={},tool_name="contextdevmcp_get_monitor_limits",connection_name=connection_name,identifier=identifier,)print(result)Terminal window python quickstart.pyEach user signs in once. See Authorize a user for the full flow and statuses.
Tools
Pass the exact name toexecute_toolcontextdevmcp_brand_retrieve_unifiedRetrieve machine-readable company and brand intelligence—logos, colors, descriptions, socials, links, industry, location, and more—from one domain, company name, work email, stock ticker, ISIN, transaction descriptor, or direct URL.Read-onlyGet brand intelligence
Retrieve machine-readable company and brand intelligence—logos, colors, descriptions, socials, links, industry, location, and more—from one domain, company name, work email, stock ticker, ISIN, transaction descriptor, or direct URL. Use get-brand for a visual card from a domain; use this tool for raw structured data or non-domain lookups.
Inputs
bodystringrequired- Brand lookup request. Provide exactly one lookup type: domain, company name, email, stock ticker, direct URL, or transaction descriptor.
contextdevmcp_brand_searchSearch indexed brands by company name or domain and return up to 10 lightweight matches.Read-onlySearch brands
Search indexed brands by company name or domain and return up to 10 lightweight matches. Supports prefix autocomplete, field selection, and typo tolerance. Use brand-retrieve-unified for a full profile or get-brand for a visual domain card.
Inputs
querystringrequired- Search term, matched against the fields selected by queryBy (e.g. 'nike', 'nike.com', 'nik').
autocompleteboolean- Whether the search term matches by prefix, so partial words match as they are typed (e.g. 'nik' matches Nike). Set to false to match whole words only.
queryByarray- Fields to match the search term against, as a comma-separated list or repeated parameter: 'name', 'domain', or both. Defaults to both.
tagsarray- Comma-separated labels for filtering usage, e.g. `production,team-alpha`.
typoToleranceinteger- Maximum number of typos tolerated when matching, from 0 to 2. Defaults to 0 (no typo tolerance).
contextdevmcp_get_batchRetrieve one batch's status, progress, timing, credit accounting, errors, and download links when complete.Read-onlyGet batch status
Retrieve one batch's status, progress, timing, credit accounting, errors, and download links when complete. Poll this after submit-batch; use get-batch-results only after the batch has completed.
Inputs
batch_idstringrequired- Batch ID.
contextdevmcp_get_batch_resultsPage through the successful and failed URL results of a completed batch as JSON.Read-onlyGet batch results
Page through the successful and failed URL results of a completed batch as JSON. Use the returned cursor to continue when more results exist. For progress before completion, use get-batch instead.
Inputs
batch_idstringrequired- Batch ID.
cursorstring- next_cursor from the previous page.
limitinteger- Records per page. Defaults to 25. A page can close early so its payload stays under ~8 MB; rely on next_cursor rather than counting records.
contextdevmcp_get_brandRetrieve live brand intelligence for a domain and render a visual Context card with its logo, colors, slogan, description, social profiles, industry, location, and key links.Read-onlyShow a brand profile
Retrieve live brand intelligence for a domain and render a visual Context card with its logo, colors, slogan, description, social profiles, industry, location, and key links. Use this when a user wants to see or inspect a company's brand. Use brand-retrieve-unified instead for raw structured data or lookup by name, email, ticker, ISIN, transaction descriptor, or direct URL.
Inputs
domainstringrequired- Domain to look up, e.g. 'stripe.com'. Bare domain, no https://.
maxSpeedboolean- Optimize for speed, skipping slower enrichment steps.
contextdevmcp_get_changeRetrieve one detected change with full text diffs, added or removed URLs, semantic evidence, confidence, importance, and the current snapshot when available.Read-onlyGet a detected change
Retrieve one detected change with full text diffs, added or removed URLs, semantic evidence, confidence, importance, and the current snapshot when available. Use after either change-listing tool when the complete evidence is needed.
Inputs
change_idstringrequired- Unique change ID returned by a monitor changes endpoint, for example `chg_123`.
contextdevmcp_get_logRetrieve one API request from the authenticated Context account by the request_id in a list-logs data entry, including its redacted retained input, response, timing, credits, status, and user agent.Read-onlyGet an API request log
Retrieve one API request from the authenticated Context account by the request_id in a list-logs data entry, including its redacted retained input, response, timing, credits, status, and user agent. Zero-data-retention requests contain metadata but no retained input or response.
Inputs
request_idstringrequired- The request ID of the logged API call.
contextdevmcp_get_monitorRetrieve one monitor's configuration, status, schedule, target, change-detection rules, webhook settings, and current baseline by ID.Read-onlyGet monitor configuration
Retrieve one monitor's configuration, status, schedule, target, change-detection rules, webhook settings, and current baseline by ID. This reads the monitor definition; use list-monitor-runs for execution history or list-monitor-changes for detected changes.
Inputs
monitor_idstringrequired- Unique monitor ID returned by create-monitor or list-monitors, for example `mon_123`.
contextdevmcp_get_monitor_limitsRetrieve the authenticated account's current monitor count and maximum allowed monitors.Read-onlyGet monitor limits
Retrieve the authenticated account's current monitor count and maximum allowed monitors. Use before create-monitor when checking available capacity.
Inputs
This tool takes no inputs.
contextdevmcp_get_monitor_runRetrieve one run for a monitor, including lifecycle status, timing, credits charged, and the detected change when present.Read-onlyGet a monitor run
Retrieve one run for a monitor, including lifecycle status, timing, credits charged, and the detected change when present. Use after list-monitor-runs or run-monitor-now when the full outcome of one check is needed.
Inputs
monitor_idstringrequired- Unique monitor ID returned by create-monitor or list-monitors, for example `mon_123`.
run_idstringrequired- Unique monitor run ID returned by run-monitor-now or list-monitor-runs, for example `run_123`.
contextdevmcp_get_news_searchSearch live and historical news for one company, identified by exactly one name, domain, ticker with an optional exchange, or ISIN.Read-onlySearch company news
Search live and historical news for one company, identified by exactly one name, domain, ticker with an optional exchange, or ISIN. Choose at most one filter category: publisher domain, publisher country, article language, or article type; optionally add a publication date range. Paginate results with stable story IDs and verified entity relevance. Use web-search for broader topics or news that is not tied to one company.
Inputs
searchByobjectrequired- What to search for.
cursorstring- Opaque next_cursor from the previous response, or null for the first page.
filterByobject- Optional result filters. Use at most one of sourceDomain, sourceCountry, articleLanguage, or articleType. A date range may accompany that category; date.from must not exceed date.to.
limitinteger- Maximum results to return. Defaults to 10.
sortByobject- Result ordering. Defaults to newest.
tagsarray- Labels for filtering usage in the dashboard.
contextdevmcp_get_webhook_deliveryRetrieve one webhook delivery from the authenticated account, including its status and latest attempt.Read-onlyGet a webhook delivery
Retrieve one webhook delivery from the authenticated account, including its status and latest attempt. Use list-webhook-deliveries to find its delivery_id.
Inputs
delivery_idstringrequired- Delivery ID.
tagsarray- Comma-separated labels for filtering usage, e.g. `production,team-alpha`.
contextdevmcp_list_account_runsList monitor runs across the authenticated account.Read-onlyList all monitor runs
List monitor runs across the authenticated account. Use this for an organization-wide activity feed or operational overview; use list-monitor-runs when only one monitor matters.
Inputs
cursorstring- Opaque pagination cursor from a previous response.
limitinteger- Maximum number of items to return per page (1-100). Defaults to 25.
statusstring- Filter runs by lifecycle status.one of
queuedrunningcompletedfailedskipped
contextdevmcp_list_batchesList asynchronous scraping batches from newest to oldest, with status, search, tag, and cursor filters.Read-onlyList scraping batches
List asynchronous scraping batches from newest to oldest, with status, search, tag, and cursor filters. Use this to find a batch ID or review account activity; it does not return page-level results.
Inputs
cursorstring- Cursor from the previous page.
limitinteger- Batches per page. Defaults to 25.
qstring- Free-text search term, matched against the batch id, crawl source (start URL or sitemap domain), and tags.
search_typestring- `prefix` for as-you-type prefix matching (default), `exact` for full-token matching.one of
exactprefix statusstring- Filter by status.one of
queuedrunningcancellingcompletedcancelledfailed tagsstring- Comma-separated list of tags to filter by (matches batches having any of them).
contextdevmcp_list_changesList detected changes across all monitors in the authenticated account, with monitor, type, time, and tag filters.Read-onlyList all detected changes
List detected changes across all monitors in the authenticated account, with monitor, type, time, and tag filters. Use this for an account-wide change feed; use list-monitor-changes for one monitor.
Inputs
change_detection_typestring- Filter by change detection type.one of
exactsemantic cursorstring- Opaque pagination cursor from a previous response.
limitinteger- Maximum number of items to return per page (1-100). Defaults to 25.
monitor_idstring- Unique monitor ID returned by create-monitor or list-monitors, for example `mon_123`.
sincestring- Only include items at or after this ISO 8601 timestamp.
tagstring- Filter to items that have this tag.
target_typestring- Filter by target type.one of
pagesitemapextract untilstring- Only include items before this ISO 8601 timestamp.
contextdevmcp_list_logsList recent API requests from the authenticated Context account, newest first.Read-onlyList API request logs
List recent API requests from the authenticated Context account, newest first. Filter by time, endpoint path, API key ID, HTTP status, error code, tags, or request content. Use errors_only to investigate failures, then pass the request_id from a data entry to get-log for the retained request and response. Defaults to the last 24 hours and does not create another usage-log entry.
Inputs
error_codestring- Filter by the `error_code` returned in the response.
errors_onlyboolean- Only include requests that returned a 4xx or 5xx status.
fromstring- Only include requests at or after this ISO 8601 timestamp. Defaults to 24 hours before `to`.
key_idstring- Filter by the API key that made the request.
limitinteger- Number of log entries per page.
pageinteger- Page number, starting at 1.
pathstring- Filter by endpoint path, with or without the /v1 prefix.
searchstring- Case-insensitive substring match against the request query and body, e.g. a domain.
status_codeinteger- Filter by exact HTTP status code.
tagsstring- Comma-separated request tags. Matches requests carrying any of them. Up to 20 tags, each 1-50 characters.
tostring- Only include requests at or before this ISO 8601 timestamp. Defaults to now.
contextdevmcp_list_monitor_changesList changes detected by one monitor, with time and tag filters.Read-onlyList changes for a monitor
List changes detected by one monitor, with time and tag filters. Use this for a monitor-specific change history, then call get-change when full diffs, evidence, confidence, and importance are needed.
Inputs
monitor_idstringrequired- Unique monitor ID returned by create-monitor or list-monitors, for example `mon_123`.
cursorstring- Opaque pagination cursor from a previous response.
limitinteger- Maximum number of items to return per page (1-100). Defaults to 25.
sincestring- Only include items at or after this ISO 8601 timestamp.
tagstring- Filter to items that have this tag.
untilstring- Only include items before this ISO 8601 timestamp.
contextdevmcp_list_monitor_credit_usageReport credits charged by monitor over a time window, ordered by the monitors using the most credits.Read-onlyGet monitor credit usage
Report credits charged by monitor over a time window, ordered by the monitors using the most credits. Use this for spend analysis and optimization, not for run or change details.
Inputs
sincestring- Only include items at or after this ISO 8601 timestamp.
untilstring- Only include items before this ISO 8601 timestamp.
contextdevmcp_list_monitor_runsList the execution history of one monitor, including run status, timing, credits, and whether each run detected a change.Read-onlyList runs for a monitor
List the execution history of one monitor, including run status, timing, credits, and whether each run detected a change. Use get-monitor-run for the full details of one run.
Inputs
monitor_idstringrequired- Unique monitor ID returned by create-monitor or list-monitors, for example `mon_123`.
cursorstring- Opaque pagination cursor from a previous response.
limitinteger- Maximum number of items to return per page (1-100). Defaults to 25.
statusstring- Filter runs by lifecycle status.one of
queuedrunningcompletedfailedskipped
contextdevmcp_list_monitorsList recurring monitors in the authenticated Context account, with search, status, target-type, tag, and cursor filters.Read-onlyList monitors
List recurring monitors in the authenticated Context account, with search, status, target-type, tag, and cursor filters. Use this to find a monitor ID before reading, updating, running, or deleting it; this does not return run history or detected changes.
Inputs
change_detection_typestring- Filter by change detection type.one of
exactsemantic cursorstring- Opaque pagination cursor from a previous response.
limitinteger- Maximum number of items to return per page (1-100). Defaults to 25.
qstring- Free-text search term, matched against the fields named in `search_by`.
search_byarray- Fields to search with `q`. Defaults to all fields; page and extract targets can have instructions.
search_typestring- `prefix` for as-you-type prefix matching (default), `exact` for full-token matching.one of
exactprefix statusstring- Filter monitors by lifecycle status.one of
activepausedfailed tagstring- Filter to items that have this tag.
tagsarray- Comma-separated list of tags to filter by (matches monitors having any of them).
target_typestring- Filter by target type.one of
pagesitemapextract
contextdevmcp_list_webhook_deliveriesList the authenticated account's batch or monitor webhook deliveries, newest first.Read-onlyList webhook deliveries
List the authenticated account's batch or monitor webhook deliveries, newest first. Select the source type and filter by batch, monitor, run, status, or creation time. Use get-webhook-delivery or list-webhook-delivery-attempts for delivery details.
Inputs
bodystringrequired- Webhook delivery filters. Choose batch or monitor as the source type, then optionally filter by source ID, status, creation time, and pagination cursor.
contextdevmcp_list_webhook_delivery_attemptsList attempts for one webhook delivery, newest first, with delivery outcomes for troubleshooting.Read-onlyList webhook delivery attempts
List attempts for one webhook delivery, newest first, with delivery outcomes for troubleshooting. Use retry-webhook-delivery when another delivery attempt is needed.
Inputs
delivery_idstringrequired- Delivery ID.
cursorstring- The next_cursor from the previous response.
limitinteger- Number of attempts to return.
tagsarray- Comma-separated labels for filtering usage, e.g. `production,team-alpha`.
contextdevmcp_people_enrichEnrich one person from combined identity clues and return a profile with an identity match score.Read-onlyEnrich a person
Enrich one person from combined identity clues and return a profile with an identity match score. Provide a person email, a person-profile social URL, or both first and last name with company, education, or location. Use brand-retrieve-unified for company data.
Inputs
companyobject- Company context to help identify the person. Provide a name or domain.
educationarray- Education history to help distinguish people with similar names.
emailstring- Email address of the person to find.
locationobject- Location context to help identify the person. Provide a city, region, or country.
nameobject- Person name. Without an email or person-profile URL, provide both first and last name plus company, education, or location.
social_urlsarray- Public profile URLs for the person. A person-profile URL can identify the person without a name.
tagsarray- Labels for filtering usage in the dashboard.
timeoutOptsobject- Request deadline and what to return when it passes.
zdrstring- `enabled` turns on zero data retention. Returns 403 `ZDR_NOT_ENABLED` unless your organization has ZDR.one of
enableddisabled
contextdevmcp_web_answersResearch the live web and return a sourced answer in the exact JSON shape requested.Read-onlyAnswer a web research question
Research the live web and return a sourced answer in the exact JSON shape requested. Use fast for focused questions that should finish quickly or ultra for deeper research. Use web-search when ranked links or snippets are enough, or web-scrape with jsonParams when the source URL and extraction schema are already known.
Inputs
taskstringrequired- Research task. Name a domain to have it read before searching.
json_formatobject- Example object whose keys and value types define the answer shape. Unknown values may be null.
modestring- `fast` for short tasks; `ultra` for deeper research (default).one of
fastultra tagsarray- Labels for filtering usage in the dashboard.
timeoutOptsobject- Request deadline and what to return when it passes.
zdrstring- `enabled` turns on zero data retention. Returns 403 `ZDR_NOT_ENABLED` unless your organization has ZDR.one of
enableddisabled
contextdevmcp_web_crawlStart from a URL, follow relevant internal links, and return clean Markdown for multiple pages in one synchronous request.Read-onlyCrawl a website
Start from a URL, follow relevant internal links, and return clean Markdown for multiple pages in one synchronous request. Use this for focused multi-page research when results are needed immediately. Use web-map for URLs only or submit-batch for large jobs that should run asynchronously.
Inputs
urlstringrequired- Start URL, including `http://` or `https://`.
countrystring- Fetch from this country (ISO 3166-1 alpha-2).one of
adaeafagaialamaoaratauawazbabbbdbebfbgbhbibjbmbnbobqbrbsbwbybzcacdcfcgchciclcmcncocrcvcwcyczdedjdkdmdodzeceeegesetfifjfrgagbgdgegfggghgmgngpgqgrgtgugwgyhkhnhrhthuidieiliminiqirisitjejmjojpkekgkhknkrkwkykzlalblclklrlsltlulvlymamcmdmemfmgmkmlmmmnmomqmrmtmumvmwmxmymznancnengninlnonpnzompapepfpgphpkplprpsptpyqarerorsrurwsascsdsesgsiskslsmsnsosrssstsvsxsysztctdtgthtjtltmtntrtttwtzuaugusuyuzvcvevgvivnyeytzazmzw excludeSelectorsarray- Remove matching elements after inclusions. Exclusions take precedence.
followSubdomainsboolean- When true, follow links on subdomains of the starting URL's domain (e.g. docs.example.com when starting from example.com). www and apex are always treated as equivalent.
includeFramesboolean- When true, the contents of iframes are rendered to Markdown for each crawled page.
includeImagesboolean- Include image references in the Markdown output
includeLinksboolean- Preserve hyperlinks in the Markdown output
includeSelectorsarray- Keep matching HTML subtrees before converting each page to Markdown.
maxAgeMsinteger- Maximum cache age in milliseconds. Defaults to 1 day; `0` fetches fresh.
maxDepthinteger- Maximum link depth from the starting URL (0 = only the starting page)
maxPagesinteger- Maximum pages to crawl.
pdfobject- PDF handling. `start`/`end` limit parsing to an inclusive, 1-based page range.
settleAnimationsboolean- Wait briefly for CSS animations and transitions to settle before reading each page.
shortenBase64Imagesboolean- Truncate base64-encoded image data in the Markdown output
stopAfterMsinteger- Soft crawl deadline in milliseconds. Returns pages collected before the next deadline check.
tagsarray- Labels for filtering usage in the dashboard.
timeoutOptsobject- Request deadline and what to return when it passes.
urlRegexstring- Regex pattern. Only URLs matching this pattern will be followed and scraped. An automatic prefix scope in the form ^<starting URL> follows a redirect of the starting page.
useMainContentOnlyboolean- Extract only the main content, stripping headers, footers, sidebars, and navigation
waitForMsinteger- Browser wait time in milliseconds after initial page load for each crawled page. Defaults to 3500 (3.5 seconds). Min: 0. Max: 30000 (30 seconds).
zdrstring- `enabled` turns on zero data retention. Returns 403 `ZDR_NOT_ENABLED` unless your organization has ZDR.one of
enableddisabled
contextdevmcp_web_mapMap a website's URLs using Context's index, with available page titles, descriptions, keywords, and languages.Read-onlyMap URLs
Map a website's URLs using Context's index, with available page titles, descriptions, keywords, and languages. Filter by URL pattern or search phrase without retrieving every page body. Use web-scrape for one page, web-crawl for content from several pages, or submit-batch for large asynchronous collection.
Inputs
domainstringrequired- Domain to map, e.g. `stripe.com`.
headersobject- HTTP headers for the target origin. Non-empty headers bypass caching.
includeSubdomainsboolean- Include URLs on subdomains.
maxLinksinteger- Maximum number of URLs to return.
searchstring- Filter URLs by a topic or phrase, most relevant first.
sitemapUrlstring- Fetch this sitemap instead of discovering sitemaps. Must belong to the domain or a subdomain.
tagsarray- Comma-separated labels for filtering usage, e.g. `production,team-alpha`.
timeoutOptsobject- Request deadline and what to return when it passes.
urlRegexstring- Optional RE2-compatible regex pattern. Only URLs matching this pattern are returned and counted against maxLinks.
zdrstring- `enabled` turns on zero data retention. Returns 403 `ZDR_NOT_ENABLED` unless your organization has ZDR.one of
enableddisabled
contextdevmcp_web_searchSearch the live web and optionally scrape ranked results to Markdown in the same call.Read-onlySearch the live web
Search the live web and optionally scrape ranked results to Markdown in the same call. Use this to discover sources, answer current questions, or research a topic when the exact page URL is unknown. When a URL is already known, use web-scrape instead. Use web-answers when the user wants a sourced JSON answer rather than ranked links.
Inputs
querystringrequired- Search query. Accepts natural language as well as Google-style search operators such as `site:`, `-site:`, `inurl:`, `intitle:`, quoted phrases, and `OR`.
countrystring- Two-letter ISO 3166-1 alpha-2 country code to localize results to a specific country (maps to Google's `gl` parameter). Example: "us", "gb", "de".one of
afaldzasadaoaiaqagaramawauatazbsbhbdbbbybebzbjbmbtbobabwbvbriobnbgbfbikhcmcacvkycftdclcncxcccokmcgcdckcrcihrcucyczdkdjdmdoecegsvgqereeetfkfofjfifrgfpftfgagmgedeghgigrglgdgpgugtgngwgyhthmvahnhkhuisinidiriqieilitjmjpjokzkekikpkrkwkglalvlblslrlyliltlumomkmgmwmymvmlmtmhmqmrmuytmxfmmdmcmnmsmamzmmnanrnpnlanncnzninengnunfmpnoompkpwpspapgpypephpnplptprqarerorurwshknlcpmvcwssmstsasnrsscslsgsksisbsozagseslksdsrsjszsechsytwtjtzthtltgtktotttntrtmtctvuguaaegbusumuyuzvuvevnvgviwfehyezmzw excludeDomainsarray- Blocklist — drop results from these domains. Example: ["pinterest.com", "reddit.com"].
freshnessstring- Restrict results to content published within this window.one of
last_24_hourslast_weeklast_monthlast_year includeDomainsarray- Allowlist — only return results from these domains. Example: ["arxiv.org", "github.com"].
markdownOptionsobject- Inline Markdown scraping for each result. Set `enabled: true` to activate.
numResultsinteger- Number of results to request and return (10–100). Defaults to 10.
queryFanoutboolean- Currently has no effect.
tagsarray- Labels for filtering usage in the dashboard.
timeoutOptsobject- Request deadline and what to return when it passes.
zdrstring- `enabled` turns on zero data retention. Returns 403 `ZDR_NOT_ENABLED` unless your organization has ZDR.one of
enableddisabled
contextdevmcp_web_styleguideExtract a website's design system, including colors, typography, spacing, shadows, and interface cues.Read-onlyExtract a website style guide
Extract a website's design system, including colors, typography, spacing, shadows, and interface cues. Use this to reproduce a brand accurately in generated UI, design audits, or creative workflows.
Inputs
colorSchemestring- Optional browser color scheme to emulate for websites that respond to prefers-color-scheme. This value is part of the styleguide cache key.one of
lightdark directUrlstring- Exact URL to inspect. Provide either `domain` or `directUrl`, not both.
domainstring- Domain name to extract styleguide from (e.g., 'example.com', 'google.com'). The domain will be automatically normalized and validated. You must provide either 'domain' or 'directUrl', but not both.
maxAgeMsinteger- Maximum age of cached brand data in ms. Defaults to 3 months; clamped to 0–1 year. `0` refreshes.
tagsarray- Comma-separated labels for filtering usage, e.g. `production,team-alpha`.
timeoutOptsobject- Request deadline and what to return when it passes.
zdrstring- `enabled` turns on zero data retention. Returns 403 `ZDR_NOT_ENABLED` unless your organization has ZDR.one of
enableddisabled
contextdevmcp_create_monitorCreate a recurring monitor for a page, sitemap, or structured extraction target.WriteCreate a recurring monitor
Create a recurring monitor for a page, sitemap, or structured extraction target. Use this when the user wants ongoing change detection, not a one-time scrape. Configure the target, schedule, change detection, and optional webhook; Context immediately runs an initial baseline and returns the monitor.
Inputs
namestringrequired- Human-readable monitor name used to identify it in lists, runs, changes, and notifications.
targetstringrequired- What to watch: a page, a sitemap, or data extracted from a site.
change_detectionstring- How changes are judged. Defaults to `semantic` for extract targets and page targets with `instructions`, otherwise `exact`.
modestring- Always `web`. Optional.one of
web scheduleobject- How often the monitor runs. Defaults to once a day.
tagsarray- Labels for filtering monitors, their changes, and their usage.
webhookstring- Optional webhook configuration for delivering monitor change notifications.
contextdevmcp_parse_documentSend PDF, Office, spreadsheet, presentation, image, code, data, or text file bytes to Context and convert them into clean Markdown for agents, analysis, and RAG.WriteParse a file to Markdown
Send PDF, Office, spreadsheet, presentation, image, code, data, or text file bytes to Context and convert them into clean Markdown for agents, analysis, and RAG. Use this when the source is a file rather than a URL. This transformation consumes Context credits but does not alter the original file.
Inputs
fileBase64stringrequired- Base64-encoded file bytes. Maximum decoded size: 25 MiB.
clientstring- Optional client identifier used for usage attribution.
extensionstring- Optional file extension hint, such as pdf, docx, xlsx, pptx, html, json, csv, md, py, rtf, jpg, png, or txt.one of
txttextmdmarkdownhtmlhtmxhtmlxmlrssatomcsvtsvyamlymlpyjavajsjsxmjscjsjsonjsonlndjsonphpshbashzshfishrbtstsxrtfsrtcssscsslessstylsasssvgpdfdocxdocxlsxxlsmxlsbxltxxltmxlspptxpptmppsxppsmpotxpotmpptppspotjpgjpegjpepnggifbmptifftifwebpppmpbmpgmpnm includeImagesboolean- Include image references in Markdown output
includeLinksboolean- Preserve hyperlinks in Markdown output
ocrboolean- Read text from images and scanned PDF pages. PDF page ranges still apply.
pdfobject- PDF page-range options as a JSON object, e.g. {"start": 2, "end": 5}.
shortenBase64Imagesboolean- Shorten base64-encoded image data in the Markdown output
tagsarray- Comma-separated labels for filtering usage, e.g. `production,team-alpha`.
useMainContentOnlyboolean- Extract only the main content from HTML-like inputs
zdrstring- `enabled` turns on zero data retention. Returns 403 `ZDR_NOT_ENABLED` unless your organization has ZDR.one of
enableddisabled
contextdevmcp_retry_webhook_deliveryQueue another attempt for a webhook delivery created within the last seven days.WriteRetry a webhook delivery
Queue another attempt for a webhook delivery created within the last seven days. This can send the event to its configured external receiver again. Use get-webhook-delivery or list-webhook-delivery-attempts to inspect the outcome.
Inputs
delivery_idstringrequired- Delivery ID.
forceboolean- Resend even if the delivery already succeeded. Defaults to false.
Idempotency-Keystring- Unique key to prevent duplicate retry requests.
tagsarray- Labels for filtering usage in the dashboard.
contextdevmcp_submit_batchStart an asynchronous job to scrape up to 25,000 supplied URLs or crawl a large website as Markdown or HTML.WriteSubmit a large scraping batch
Start an asynchronous job to scrape up to 25,000 supplied URLs or crawl a large website as Markdown or HTML. Use this when a synchronous scrape or crawl would be too large. When webhookUrl is supplied, Context sends a completion request to that external endpoint. The call returns a batch ID, not page results; use get-batch until it settles, then get-batch-results. Supply an Idempotency-Key when a submission may be retried.
Inputs
inputstringrequired- Batch job definition. Choose a scrape or crawl mode and provide the URLs, output format, and processing options for that mode.
Idempotency-Keystring- Unique key per submission. Retrying with the same key and body returns the original batch; a different body returns `409`.
tagsarray- Tags stored on the batch. Filter the batch list by them later.
webhookobject- Where to send the batch's final-status event. Omit `retry` for one attempt; `{}` uses the default retry schedule.
webhookUrlstring- Legacy URL notified when the batch finishes. Preserves one best-effort attempt. Cannot be combined with webhook.
contextdevmcp_submit_feedbackReport a Context problem to the Context team.WriteSubmit agent feedback
Report a Context problem to the Context team. Always use this when a tool or API behaves unexpectedly, including wrong or incomplete successful results, unexpected errors, or a docs mismatch, even after a successful workaround. Send a category, a note describing the affected tool and expected versus actual behavior, and the affected request_id, a relevant public url, or both. Use a url when no request_id is available; never invent an ID. Sanitize secrets and private data. Costs no credits. Report each distinct issue once; reporting the same request_id again returns the original feedback_id. If this tool fails, do not recursively report its failure or loop on retries.
Inputs
categorystringrequired- Kind of issue.one of
bugdocs_mismatchfrictionfeature_gapquality_degradationother notestringrequired- What went wrong and what you expected instead.
request_idstring- The request_id of the API call the feedback is about, from its response body or X-Request-Id header.
tagsarray- Labels for filtering usage in the dashboard.
urlstring- The page the feedback is about, such as one page of a crawl or a docs page.
contextdevmcp_cancel_batchStop a queued or running batch from starting additional pages.DestructiveCancel a batch
Stop a queued or running batch from starting additional pages. Work already in progress finishes and unused reserved credits are refunded after settlement. This does not delete stored results; use only when the user explicitly wants processing stopped.
Inputs
batch_idstringrequired- Batch ID.
contextdevmcp_delete_batchPermanently delete a completed, cancelled, or failed batch and its stored results.DestructiveDelete a batch
Permanently delete a completed, cancelled, or failed batch and its stored results. Active batches must be cancelled and allowed to settle first. This cannot be undone; use only when the user explicitly requests deletion.
Inputs
batch_idstringrequired- Batch ID.
contextdevmcp_delete_monitorPermanently delete a monitor and stop all future scheduled runs.DestructiveDelete a monitor
Permanently delete a monitor and stop all future scheduled runs. This cannot be undone; use only when the user explicitly wants the monitor removed.
Inputs
monitor_idstringrequired- Unique monitor ID returned by create-monitor or list-monitors, for example `mon_123`.
contextdevmcp_rotate_monitor_webhook_secretReplace a monitor's webhook signing secret and return its updated configuration.DestructiveRotate a monitor webhook secret
Replace a monitor's webhook signing secret and return its updated configuration. The previous secret stops signing deliveries immediately; update the webhook receiver to use the returned secret. Requires a monitor with a configured webhook URL.
Inputs
monitor_idstringrequired- Unique monitor ID returned by create-monitor or list-monitors, for example `mon_123`.
contextdevmcp_run_monitor_nowQueue an immediate check for a monitor outside its regular schedule.DestructiveRun a monitor now
Queue an immediate check for a monitor outside its regular schedule. This starts an asynchronous network run, may advance the monitor's stored comparison baseline, and can notify its configured external webhook when a change is detected. Use get-monitor-run or list-monitor-runs to follow its outcome.
Inputs
monitor_idstringrequired- Unique monitor ID returned by create-monitor or list-monitors, for example `mon_123`.
contextdevmcp_update_monitorUpdate an existing monitor's configuration, including its optional external webhook.DestructiveUpdate a monitor
Update an existing monitor's configuration, including its optional external webhook. Changes affect future runs, and changing the target or change-detection definition creates a new baseline. Use get-monitor first when the current configuration must be preserved.
Inputs
monitor_idstringrequired- Unique monitor ID returned by create-monitor or list-monitors, for example `mon_123`.
change_detectionstring- How changes are judged. Defaults to `semantic` for extract targets and page targets with `instructions`, otherwise `exact`.
namestring- New human-readable name for the monitor.
scheduleobject- How often the monitor runs. Defaults to once a day.
statusstring- New monitor lifecycle status: active continues scheduled runs; paused stops them until reactivated.one of
activepaused tagsarray- Labels for filtering monitors, their changes, and their usage.
targetstring- What to watch: a page, a sitemap, or data extracted from a site.
webhookstring- Set to null to remove the webhook. Changing `url` issues a new secret.
contextdevmcp_web_scrapeScrape one known URL and return any combination of HTML, Markdown, a screenshot, page images, original bytes, CSS-selected fields, relevant highlights, schema-shaped JSON, or product data.DestructiveScrape a URL
Scrape one known URL and return any combination of HTML, Markdown, a screenshot, page images, original bytes, CSS-selected fields, relevant highlights, schema-shaped JSON, or product data. Supports browser actions, custom target headers, PDF parsing, deadlines, and zero data retention. Browser clicks can change the target site's state. Use web-search when the URL is unknown, web-map for URLs only, web-crawl for linked pages, or submit-batch for large asynchronous jobs.
Inputs
formatsobjectrequired- Outputs to return. Set at least one to `true`.
urlstringrequired- Public HTTP or HTTPS URL to scrape.
highlightsParamsobject- Required when `formats.highlights` is `true`.
imageParamsobject- Image options. Requires formats.images: true.
jsonParamsobject- Required when formats.json is true.
markdownParamsobject- Markdown options. Requires `formats.markdown`.
maxAgeMsinteger- Maximum age of a cached output, in milliseconds. `0` fetches fresh. Defaults to 1 day.
parseParamsobject- Required when formats.parse is true.
productParamsobject- Product options. Requires formats.product: true.
screenshotParamsobject- Screenshot options. Requires formats.screenshot: true.
sharedParamsobject- Browser and content settings shared by all outputs.
tagsarray- Labels for tracking request usage. Not retained when zdr is enabled.
timeoutOptsobject- Deadline for the whole request. Defaults to 60000 ms with `fail`. Fixed waits must end before it.
zdrstring- `enabled` turns on zero data retention. Your organization must have ZDR enabled.one of
enableddisabled
No tools match.