The Slite MCP connector routes your AI agent's tool calls to Slite's own MCP server through Scalekit. Each user signs in to Slite once, and Scalekit stores and refreshes their tokens, so your agent never handles credentials. It comes with 41 tools.
- Tools
- 41
- What they doRead · write · destructive
- 18 · 13 · 1018 read13 write10 destructive
- Users sign in with
- OAuth
- OAuth app
- Scalekit's or your own
Setup
Install the SDK
Terminal window npm install @scalekit-sdk/node dotenvTerminal window pip install scalekit-sdk-python python-dotenvSet your credentials
Add your Scalekit credentials to your
.envfile. Find values in app.scalekit.com > Developers > API Credentials..env SCALEKIT_ENVIRONMENT_URL=<your-environment-url>SCALEKIT_CLIENT_ID=<your-client-id>SCALEKIT_CLIENT_SECRET=<your-client-secret>Create the Slite MCP connection
In AgentKit > Connections, create a Slite MCP connection. The name you give it is the
connection_nameyour code passes. See Configure connections.Scalekit credentials are available for Slite MCP server, so you don't need to register an OAuth app.
Authorize a user and make your first call
quickstart.mts import { ScalekitClient } from '@scalekit-sdk/node'import 'dotenv/config'import { createInterface } from 'node:readline/promises'const scalekit = new ScalekitClient(process.env.SCALEKIT_ENVIRONMENT_URL,process.env.SCALEKIT_CLIENT_ID,process.env.SCALEKIT_CLIENT_SECRET,)const actions = scalekit.actionsconst connector = 'slitemcp'const identifier = 'user_123'// Generate an authorization link for the userconst { link } = await actions.getAuthorizationLink({ connectionName: connector, identifier })console.log('Authorize Slite MCP:', link)const rl = createInterface({ input: process.stdin, output: process.stdout })await rl.question('Press Enter after authorizing...')rl.close()// Make your first callconst result = await actions.executeTool({connector,identifier,toolName: 'slitemcp_list-channels',toolInput: {},})console.log(result)Terminal window npx tsx quickstart.mtsquickstart.py import osfrom scalekit import ScalekitClientfrom dotenv import load_dotenvload_dotenv()scalekit_client = ScalekitClient(env_url=os.getenv("SCALEKIT_ENVIRONMENT_URL"),client_id=os.getenv("SCALEKIT_CLIENT_ID"),client_secret=os.getenv("SCALEKIT_CLIENT_SECRET"),)actions = scalekit_client.actionsconnection_name = "slitemcp"identifier = "user_123"# Generate an authorization link for the userlink_response = actions.get_authorization_link(connection_name=connection_name,identifier=identifier,)print("Authorize Slite MCP:", link_response.link)input("Press Enter after authorizing...")# Make your first callresult = actions.execute_tool(tool_input={},tool_name="slitemcp_list-channels",connection_name=connection_name,identifier=identifier,)print(result)Terminal window python quickstart.pyEach user signs in once. See Authorize a user for the full flow and statuses.
Tools
Pass the exact name toexecute_toolslitemcp_ask-sliteAsk a question and get an AI-generated answer with source citations from your workspace.Read-onlyAsk Slite
Ask a question and get an AI-generated answer with source citations from your workspace.
Inputs
questionstringrequired- The question to ask Slite.
parentNoteIdstring- Optional filter to only search within notes under this parent note id.
slitemcp_get-comment-thread-on-noteRetrieve a single comment thread by its note and thread IDs.Read-onlyGet Comment Thread On Note
Retrieve a single comment thread by its note and thread IDs.
Inputs
noteIdstringrequired- The ID of the note the thread belongs to.
threadIdstringrequired- The ID of the comment thread to retrieve.
slitemcp_get-noteRetrieve a note's content by ID, returning sliteml with block IDs or plain Markdown.Read-onlyGet Note
Retrieve a note's content by ID, returning sliteml with block IDs or plain Markdown.
Inputs
noteIdstringrequired- The ID of the note to retrieve.
cursorstring- Block ID to resume from. Pass the `nextCursor` returned by a previous partial call to continue reading. Only applies when fullContent=false.
endBlockIdstring- Optional: return only blocks up to and including this one (inclusive). Combine with startBlockId. Only applies to format=sliteml.
formatstring- Format of the content to return. Default: sliteml (the rich-text format with block IDs â required before any editing operation). Options: md (markdown export, no block IDs), html (HTML export, no block IDs), collection (column definitions and records â collection notes only; archived rows are excluded unless includeArchivedRows is set).one of
mdhtmlslitemlcollection fullContentboolean- Return the full document content. Default true. Set to false to fetch only a preview (about the first 2000 chars, ending on a block boundary) â useful when iterating on a long doc; pair with `cursor` to continue. Ignored when startBlockId/endBlockId are provided.
includeArchivedRowsboolean- Only applies to format=collection. Archived rows are excluded by default. Set to true to also return archived rows, each marked with `archived: true`.
startBlockIdstring- Optional: return only the slice of the doc from this block onward (inclusive). Combine with endBlockId to fetch a specific range. Only applies to format=sliteml.
slitemcp_get-note-childrenList child notes under a parent note (paginated).Read-onlyGet Note Children
List child notes under a parent note (paginated).
Inputs
noteIdstringrequired- The ID of the parent note.
cursorstring- Cursor to use to continue fetching the note children (for pagination when there are more than 50 children).
slitemcp_get-userRetrieve a user by ID, including their name, email, and role.Read-onlyGet User
Retrieve a user by ID, including their name, email, and role.
Inputs
userIdstringrequired- The ID of the user to retrieve.
slitemcp_get-user-groupRetrieve a user group by ID, including its name, description, and members.Read-onlyGet User Group
Retrieve a user group by ID, including its name, description, and members.
Inputs
userGroupIdstringrequired- The ID of the user group to retrieve.
slitemcp_list-channelsList channels accessible to the current user (paginated).Read-onlyList Channels
List channels accessible to the current user (paginated).
Inputs
cursorstring- Cursor for pagination when there are more results.
slitemcp_list-comment-threadsList all non-archived comment threads on a note, oldest-first, with full content.Read-onlyList Comment Threads
List all non-archived comment threads on a note, oldest-first, with full content.
Inputs
noteIdstringrequired- The ID of the note to list threads on.
slitemcp_list-empty-notes-for-knowledge-managementList empty notes for knowledge management, filterable by channel, owner, and pagination cursor.Read-onlyList Empty Notes For Knowledge Management
List empty notes for knowledge management, filterable by channel, owner, and pagination cursor.
Inputs
channelIdListarray- Optional channel IDs to filter notes by channel.
cursorstring- Cursor for pagination when there are more results.
firstinteger- Maximum number of notes to return. Defaults to 20.
ownerIdListarray- Optional user or user group IDs to filter notes by owner.
slitemcp_list-inactive-notes-for-knowledge-managementList inactive notes for knowledge management, filterable by channel, owner, and pagination cursor.Read-onlyList Inactive Notes For Knowledge Management
List inactive notes for knowledge management, filterable by channel, owner, and pagination cursor.
Inputs
channelIdListarray- Optional channel IDs to filter notes by channel.
cursorstring- Cursor for pagination when there are more results.
firstinteger- Maximum number of notes to return. Defaults to 20.
ownerIdListarray- Optional user or user group IDs to filter notes by owner.
slitemcp_list-notes-for-knowledge-managementList notes for knowledge management, filterable by review state, channel, owner, and age.Read-onlyList Notes For Knowledge Management
List notes for knowledge management, filterable by review state, channel, owner, and age.
Inputs
channelIdListarray- Optional channel IDs to filter notes by channel.
cursorstring- Cursor for pagination when there are more results.
firstinteger- Maximum number of notes to return. Defaults to 20.
ownerIdListarray- Optional user or user group IDs to filter notes by owner.
reviewStateListarray- Optional filter to return notes in special review states.
sinceDaysAgonumber- Optional time window for popularity.
slitemcp_list-public-notes-for-knowledge-managementList public notes for knowledge management, filterable by review state, channel, owner, and age.Read-onlyList Public Notes For Knowledge Management
List public notes for knowledge management, filterable by review state, channel, owner, and age.
Inputs
channelIdListarray- Optional channel IDs to filter notes by channel.
cursorstring- Cursor for pagination when there are more results.
firstinteger- Maximum number of notes to return. Defaults to 20.
ownerIdListarray- Optional user or user group IDs to filter notes by owner.
reviewStateListarray- Optional filter to return notes in special review states.
sinceDaysAgonumber- Optional time window for public notes.
slitemcp_list-recently-edited-notesList the last 10 notes recently edited by the current user.Read-onlyList Recently Edited Notes
List the last 10 notes recently edited by the current user.
Inputs
cursorstring- Cursor for pagination when there are more results.
slitemcp_list-recently-visited-notesList the last 10 notes recently visited by the current user.Read-onlyList Recently Visited Notes
List the last 10 notes recently visited by the current user.
Inputs
cursorstring- Cursor for pagination when there are more results.
slitemcp_read_threadRead an AI thread back as question/answer rounds.Read-onlyRead Thread
Read an AI thread back as question/answer rounds. Use it to poll a processing response from ask-slite or slite-agent, or to read a past conversation.
Inputs
threadIdstringrequired- The thread id — from a processing response, a prior threadId, or the trailing segment of a thread URL.
slitemcp_search-notesSearch notes by keywords and return matching titles, IDs, and text highlights.Read-onlySearch Notes
Search notes by keywords and return matching titles, IDs, and text highlights.
Inputs
querystringrequired- The search query to perform.
hitsPerPagenumber- Specify how many notes to return per page.
includeArchivedboolean- Optional filter to also include archived notes in the search results (default to false).
lastEditedAfterstring- Optional filter to only return notes edited after a specific date (ISO 8601 format).
pagenumber- Used to perform pagination on search.
parentNoteIdstring- Optional filter to only return notes under this parent note id.
reviewStatestring- Optional filter to return notes in a special review state.one of
VerifiedOutdatedVerificationRequestedVerificationExpired
slitemcp_search-user-groupsSearch and list user groups in the organization by name.Read-onlySearch User Groups
Search and list user groups in the organization by name.
Inputs
cursorstring- Cursor for pagination when there are more results.
querystring- Optional search query to filter groups by name.
slitemcp_search-usersSearch and list users in the organization by name or email.Read-onlySearch Users
Search and list users in the organization by name or email.
Inputs
cursorstring- Cursor for pagination when there are more results.
includeArchivedboolean- Set to true to also include archived (deactivated) users. Defaults to false.
querystring- Optional search query to filter users by name, email, or username.
slitemcp_append-blocksAppend sliteml content blocks to an existing note, optionally anchoring them before or after a specific block.WriteAppend Blocks
Append sliteml content blocks to an existing note, optionally anchoring them before or after a specific block.
Inputs
noteIdstringrequired- The ID of the note to append blocks to.
slitemlstringrequired- sliteml content blocks to insert. Block IDs are auto-generated and returned in changedContent.
afterBlockIdstring- Block ID to insert after; read from trailing {#blockId} markers in a get-note response.
beforeBlockIdstring- Block ID to insert before; read from trailing {#blockId} markers in a get-note response.
returnFullDocumentboolean- If true, include the full updated document in the response. Defaults to false.
slitemcp_create-channelCreate a new channel (top-level container for notes) and become its first member.WriteCreate Channel
Create a new channel (top-level container for notes) and become its first member.
Inputs
namestringrequired- The name of the channel to create.
iconColorstring- Optional icon color. Paired with iconShape.one of
darkgreyyelloworangepinkpurpleblueturquoisegreen iconShapestring- Optional icon shape for the channel doc. Pick an icon dictionary key (e.g. "book", "rocket") â no colons. Defaults to the channel icon when not specified.one of
100bulbiphonedesktop_computercomputerphoneemailvideo_camerastudio_microphonemicrophoneradiowriting_handthought_balloonspeech_balloonmemomegahammerhammer_and_wrenchgearframe_with_picturefile_folderspiral_note_padbriefcasechartbar_chartbooksscrollcalendarbookpencil2clipboardpaperclipmageyeseyeworld_maptriangular_flag_on_postglobe_with_meridiansrocketairplanecarmotorwaydartsparkleselectric_plugzaphandshakewavefirecrystal_ballno_entry_signdepartment_storecrossed_swordsbuilding_constructionconstructionmuscleboomearth_americassunnymoney_with_wingstest_tubecouch_and_lamptennisballoonanchorschool_satchelapplebasketscalespushpinartmortar_boardrobot_facepeachpackagekeyseedlingpalm_treehouseheartbelltrophyslightly_smiling_facecrescent_moonbust_in_silhouettebusts_in_silhouettering_buoy+1dollarmoneybagcredit_cardheavy_dollar_signwarningnegative_squared_cross_markinformation_sourcewhite_check_markheavy_check_markxquestionexclamationonetwothreearrow_leftarrow_rightarrow_uparrow_downarrows_counterclockwiseheavy_plus_sign typestring- Channel visibility. "public" (default) is open to all org members, "private" is restricted to invited members.one of
publicprivate
slitemcp_create-collectionCreate a new collection (structured database of notes) with typed columns.WriteCreate Collection
Create a new collection (structured database of notes) with typed columns.
Inputs
columnsarrayrequired- Column definitions for the collection. The Title column is always included automatically.
titlestringrequired- The title of the collection to create.
parentNoteIdstring- Optional ID of the parent note. If not specified, the collection will be created in your personal channel.
slitemcp_create-comment-threadCreate a new comment thread on a note, optionally anchored to a specific block or highlighted text.WriteCreate Comment Thread
Create a new comment thread on a note, optionally anchored to a specific block or highlighted text.
Inputs
contentstringrequired- Plain-text content of the first comment.
noteIdstringrequired- The ID of the note to open the thread on.
blockIdstring- Optional: when anchoring inline, the ID of the block to edit. Same as `modify-block`.
highlightstring- Optional quoted snippet shown alongside the thread in the sidebar.
slitemlstring- For inline anchoring, the updated block sliteml containing a <comment> tag with the thread ID.
slitemcp_create-noteCreate a new note with a title, optional sliteml content, and optional parent.WriteCreate Note
Create a new note with a title, optional sliteml content, and optional parent.
Inputs
titlestringrequired- The title of the note to create.
contentWidthstring- Optional doc layout width. "regular" is the default centered layout; "wide" expands the content area for tables, wide images, or side-by-side columns.one of
regularwide fieldsobject- Optional field values for collection records, keyed by column ID. Only works when parentNoteId is a collection. Use get-note with format "collection" to see available columns and their IDs. For a date column pass YYYY-MM-DD. For a users/notes column pass the entity id(s) from search-users/search-notes (comma-separated for multiple).
iconColorstring- Optional icon color. Paired with iconShape.one of
darkgreyyelloworangepinkpurpleblueturquoisegreen iconShapestring- Optional icon shape. Pick an icon dictionary key (e.g. "book", "rocket") â no colons. Collection views: "#collection_table" or "#collection_board".
listPositionstring- Optional position among siblings in the sidebar: 'top', 'bottom', or an explicit number (higher = closer to the top). If omitted, new docs are seeded at the top. Use 'bottom' when creating an ordered sequence of notes top-to-bottom.
parentNoteIdstring- Optional ID of the parent note. If not specified, the note will be created in your personal channel.
slitemlstring- Optional content for the new note. Do not start with a heading that repeats `title` â the title is rendered separately above the body. sliteml format. Core rules (do not violate â silent data loss otherwise): (1) markdown for common blocks (headings, lists, paragraphs, todos, blockquotes); XML tags for rich blocks (callout, collapsible, columns, code-block, formula, diagram, database). (2) Do NOT include a `<document>` wrapper â emit only block elements. (3) Escape literal `<`, `>`, `&` in text as `<`/`>`/`&` (except inside fenced code, code-block, formula, diagram). (4) Preserve `<comment id="...">` tags verbatim â dropping one orphans a user thread. (5) In a `<database>`, every `<column>` needs a `key`, and each `<field columnKey="...">` must match a column `key` (not its name). (6) When writing new blocks, IDs are optional and auto-generated. For the full block syntax see the "sliteml format reference" in the server instructions; if a write is rejected as invalid sliteml the full reference is returned in the error.
slitemcp_reply-to-comment-threadAdd a reply to an existing comment thread and return the updated thread.WriteReply To Comment Thread
Add a reply to an existing comment thread and return the updated thread.
Inputs
contentstringrequired- Plain-text content of the reply.
threadIdstringrequired- The ID of the comment thread to reply to.
slitemcp_resolve-comment-threadMark a comment thread as resolved.WriteResolve Comment Thread
Mark a comment thread as resolved.
- Idempotent
Inputs
threadIdstringrequired- The ID of the comment thread to resolve.
slitemcp_restore-noteRestore an archived note, making it visible in navigation and search again.WriteRestore Note
Restore an archived note, making it visible in navigation and search again.
- Idempotent
Inputs
noteIdstringrequired- The ID of the archived note to restore.
slitemcp_slite_agentInvoke Slite Agent on the workspace knowledge base.WriteSlite Agent
Invoke Slite Agent on the workspace knowledge base. Stateful: returns a threadId for follow-ups; can edit, create, or organize docs as well as read.
Inputs
taskstringrequired- The task or question for Slite Agent. Free-form natural language.
contextstring- Optional briefing for Slite Agent: what you're working on, why you're asking, what you've already established. Keep concise.
threadIdstring- Existing thread id to continue. Omit to start a new conversation. Persists across calls.
slitemcp_unresolve-comment-threadReopen a previously resolved comment thread.WriteUnresolve Comment Thread
Reopen a previously resolved comment thread.
- Idempotent
Inputs
threadIdstringrequired- The ID of the comment thread to unresolve.
slitemcp_update-channelRename a channel or change its icon color and shape.WriteUpdate Channel
Rename a channel or change its icon color and shape.
- Idempotent
Inputs
channelIdstringrequired- The ID of the channel to update.
iconColorstring- Optional new icon color. Pass null to clear.
iconShapestring- Optional new icon shape. Pick an icon dictionary key (e.g. "book", "rocket") — no colons. Pass null to clear.
namestring- Optional new name for the channel.
slitemcp_upload_filePrepare a file or image upload into a note, without passing the bytes through the model.WriteUpload File
Prepare a file or image upload into a note, without passing the bytes through the model. Workflow: 1. Call this tool with the target noteId, filename, contentType and exact byte size. 2. PUT the raw file bytes to `uploadUrl` outside MCP, sending every header in `uploadHeaders` verbatim. Do not base64-encode or transform the file: use `curl -X PUT --data-binary @path -H "Content-Type: ..." -H "Content-Disposition: attachment" "<uploadUrl>"` or `fetch(uploadUrl, { method: 'PUT', headers: uploadHeaders, body: blob })`. 3. Embed the returned `sliteml` block in the note with append-blocks, modify-block, modify-range or update-note. Add a `caption="..."` attribute if the user wants one. The block shows as broken until the PUT has completed. The signed `uploadUrl` expires after `uploadExpiresAt`; call the tool again if it did. Prepare, PUT and embed one file at a time. Images are capped at 20 MB, or the organization's lower plan-specific attachment size limit. Other files use the plan-specific limit. All uploaded files count toward the organization's storage limits, so avoid duplicate or unnecessary uploads. This tool is limited to 20 calls per minute and 60 calls per 10 minutes per user. To embed an image that already has a public URL, skip this tool and write `<image url="https://..." />` (or markdown ``) directly â Slite fetches and stores a copy.
Inputs
contentTypestringrequired- MIME type of the file, e.g. "image/png" or "application/pdf".
namestringrequired- File name with extension, e.g. "diagram.png".
noteIdstringrequired- ID of the note the file will be embedded in. You need write access to it; the file inherits its permissions.
sizeintegerrequired- Exact file size in bytes. The PUT must send exactly this many bytes.
slitemcp_verify-noteMark a note as verified, optionally with an expiration date.WriteVerify Note
Mark a note as verified, optionally with an expiration date.
- Idempotent
Inputs
noteIdstringrequired- The ID of the note to verify.
untilstring- Optional ISO 8601 date in the future when the verification should expire.
slitemcp_archive-noteArchive a note, hiding it from navigation and search until restored.DestructiveArchive Note
Archive a note, hiding it from navigation and search until restored.
- Idempotent
Inputs
noteIdstringrequired- The ID of the note to archive.
slitemcp_edit_documentApply many block edits to a single note as one atomic change — insert, replace a range, or remove blocks — instead of calling append-blocks/modify-range/remove-blocks repeatedly.DestructiveEdit Document
Apply many block edits to a single note as one atomic change — insert, replace a range, or remove blocks — instead of calling append-blocks/modify-range/remove-blocks repeatedly.
Inputs
editsarrayrequired- The ordered list of block edits to apply atomically. Each entry is an insert, modifyRange, or remove operation.
noteIdstringrequired- The ID of the note to edit.
dryRunboolean- If true, validate and return the resulting document without committing.
returnFullDocumentboolean- If true, also include the full updated document (slitemlHybrid) in the response.
slitemcp_modify-blockReplace a single block in a note with new sliteml content, identified by block ID.DestructiveModify Block
Replace a single block in a note with new sliteml content, identified by block ID.
- Idempotent
Inputs
blockIdstringrequired- ID of the block to replace; read from {#blockId} markers in a get-note response.
noteIdstringrequired- The ID of the note containing the block.
slitemlstringrequired- Replacement sliteml content for the block. Do not include the block ID in the content.
returnFullDocumentboolean- If true, include the full updated document in the response. Defaults to false.
slitemcp_modify-rangeReplace a consecutive range of blocks in a note with new sliteml content.DestructiveModify Range
Replace a consecutive range of blocks in a note with new sliteml content.
- Idempotent
Inputs
endBlockIdstringrequired- ID of the last block in the range to replace (inclusive); must follow startBlockId in document order.
noteIdstringrequired- The ID of the note containing the blocks.
slitemlstringrequired- Replacement sliteml content. Pass an empty string to delete the range.
startBlockIdstringrequired- ID of the first block in the range to replace (inclusive).
returnFullDocumentboolean- If true, include the full updated document in the response. Defaults to false.
slitemcp_move-noteMove a note to become a child of another parent note.DestructiveMove Note
Move a note to become a child of another parent note.
- Idempotent
Inputs
noteIdstringrequired- The ID of the note to move.
parentNoteIdstringrequired- The ID of the target parent note to move the note into.
listPositionstring- Optional position among the target parent's children in the sidebar: 'top', 'bottom', or an explicit number (higher = closer to the top). If omitted, the note keeps its current position value.
slitemcp_remove-blocksRemove one or more blocks from a note by their block IDs.DestructiveRemove Blocks
Remove one or more blocks from a note by their block IDs.
Inputs
blockIdsarrayrequired- The block IDs to remove. Use get-note with format="sliteml" to see available block IDs.
noteIdstringrequired- The ID of the note containing the blocks.
slitemcp_set-note-review-stateSet the review state and optional review owner of a note.DestructiveSet Note Review State
Set the review state and optional review owner of a note.
- Idempotent
Inputs
noteIdstringrequired- The ID of the note.
messagestring- Optional message. Only applicable for "out_of_date" and "verification_requested" states.
reviewStatestring- The new review state to set. Optional if only updating the review owner.one of
nonefinalout_of_dateverification_requested reviewStateManagedBystring- Optional user ID to set as the review owner for this note.
reviewStateManagedByUserGroupstring- Optional user group ID to set as the review owner for this note. Mutually exclusive with reviewStateManagedBy.
slitemcp_update_tableMake a structured edit to an in-document table (a table embedded in a doc's body) without re-emitting the whole table — add/remove columns or rows, set cell values.DestructiveUpdate Table
Make a structured edit to an in-document table (a table embedded in a doc's body) without re-emitting the whole table — add/remove columns or rows, set cell values.
Inputs
noteIdstringrequired- The ID of the note that contains the table.
tableBlockIdstringrequired- The block id of the table — the id attribute on its <database> element from get-note.
addRowsarray- Rows to append to the table, optionally with initial fields keyed by column id.
columnsarray- New typed columns to add to the table.
removeColumnsarray- Column ids to remove. Deletes all data in those columns. Cannot be reverted.
removeRowsarray- Row ids to delete.
setCellsarray- Cell values to set. For select/multi-select use the option label(s); for a text column pass the cell content; for a users/notes column pass a JSON array of resolved refs from search-users/search-notes.
slitemcp_update-collectionAdd or remove columns in a collection (structured database of notes).DestructiveUpdate Collection
Add or remove columns in a collection (structured database of notes).
Inputs
noteIdstringrequired- The ID of the collection note to update.
columnsarray- New columns to add to the collection.
removeColumnsarray- Column IDs to remove. Errors if any ID does not match an existing column.
slitemcp_update-noteUpdate an existing note's title, content, icon, or layout settings.DestructiveUpdate Note
Update an existing note's title, content, icon, or layout settings.
- Idempotent
Inputs
noteIdstringrequired- The ID of the note to update.
contentWidthstring- Optional doc layout width. "regular" is the default centered layout; "wide" expands the content area for tables, wide images, or side-by-side columns.one of
regularwide fieldsobject- Optional field values keyed by column ID. Only applies when the note is a record inside a collection. Use get-note with format "collection" on the parent to see column IDs. For a date column pass YYYY-MM-DD. For a users/notes column pass the entity id(s) from search-users/search-notes (comma-separated for multiple).
iconColorstring- Optional new icon color. Pass null to clear.
iconShapestring- Optional new icon shape. Pick an icon dictionary key (no colons), or "#collection_table" / "#collection_board" for collection views. Pass null to clear.
listPositionstring- Optional new position among siblings in the sidebar: 'top', 'bottom', or an explicit number (higher = closer to the top). Use this to reorder subpages without moving them to another parent.
slitemlstring- Optional new content. Replaces the entire rich-text body. sliteml format. Core rules (do not violate â silent data loss otherwise): (1) markdown for common blocks (headings, lists, paragraphs, todos, blockquotes); XML tags for rich blocks (callout, collapsible, columns, code-block, formula, diagram, database). (2) Do NOT include a `<document>` wrapper â emit only block elements. (3) Escape literal `<`, `>`, `&` in text as `<`/`>`/`&` (except inside fenced code, code-block, formula, diagram). (4) Preserve `<comment id="...">` tags verbatim â dropping one orphans a user thread. (5) In a `<database>`, every `<column>` needs a `key`, and each `<field columnKey="...">` must match a column `key` (not its name). (6) When writing new blocks, IDs are optional and auto-generated. For the full block syntax see the "sliteml format reference" in the server instructions; if a write is rejected as invalid sliteml the full reference is returned in the error.
titlestring- Optional new title for the note.
No tools match.
