Connect AI agents to the Miro MCP server

Vendor MCP

The Miro MCP connector routes your AI agent's tool calls to Miro's own MCP server through Scalekit. Each user signs in to Miro once, and Scalekit stores and refreshes their tokens, so your agent never handles credentials. It comes with 68 tools.

Tools: 68
What they doRead · write · destructive: 28 · 36 · 428 read36 write4 destructive
Users sign in with: OAuth
OAuth app: Scalekit's or your own

What you can do

Find and organize boards: search and create boards, and move them between spaces, sections, and teams
Build board content: add shapes, sticky notes, text, frames, diagrams, images, and code widgets to a board
Read boards: get an AI summary of a board, explore its frames and docs, and read items
Work with tables and docs: create tables, add or update rows, switch to timeline or kanban, and edit docs
Comment on boards: post comments, reply to threads, and resolve or reopen them
Share boards and spaces: grant access to users or groups and change their roles

Setup

Install the SDK
- Node.js
- Python
Terminal window
npm install @scalekit-sdk/node dotenv
Terminal window
pip install scalekit-sdk-python python-dotenv
Set your credentials
Add your Scalekit credentials to your .env file. Find values in app.scalekit.com > Developers > API Credentials.
.env
```
SCALEKIT_ENVIRONMENT_URL=<your-environment-url>
SCALEKIT_CLIENT_ID=<your-client-id>
SCALEKIT_CLIENT_SECRET=<your-client-secret>
```
Create the Miro MCP connection
In AgentKit > Connections, create a Miro MCP connection. The name you give it is the connection_name your code passes. See Configure connections.
Scalekit credentials are available for Miro, so you don't need to register an OAuth app.

Authorize a user and make your first call

Node.js
Python

1
import { ScalekitClient } from '@scalekit-sdk/node'
2
import 'dotenv/config'
3
import { createInterface } from 'node:readline/promises'
4

5
const scalekit = new ScalekitClient(
6
  process.env.SCALEKIT_ENVIRONMENT_URL,
7
  process.env.SCALEKIT_CLIENT_ID,
8
  process.env.SCALEKIT_CLIENT_SECRET,
9
)
10
const actions = scalekit.actions
11

12
const connector = 'miromcp'
13
const identifier = 'user_123'
14

15
// Generate an authorization link for the user
16
const { link } = await actions.getAuthorizationLink({ connectionName: connector, identifier })
17
console.log('Authorize Miro MCP:', link)
18
const rl = createInterface({ input: process.stdin, output: process.stdout })
19
await rl.question('Press Enter after authorizing...')
20
rl.close()
21

22
// Make your first call
23
const result = await actions.executeTool({
24
  connector,
25
  identifier,
26
  toolName: 'miromcp_board_search_boards',
27
  toolInput: {},
28
})
29
console.log(result)

npx tsx quickstart.mts

1
import os
2
from scalekit import ScalekitClient
3
from dotenv import load_dotenv
4
load_dotenv()
5

6
scalekit_client = ScalekitClient(
7
    env_url=os.getenv("SCALEKIT_ENVIRONMENT_URL"),
8
    client_id=os.getenv("SCALEKIT_CLIENT_ID"),
9
    client_secret=os.getenv("SCALEKIT_CLIENT_SECRET"),
10
)
11
actions = scalekit_client.actions
12

13
connection_name = "miromcp"
14
identifier = "user_123"
15

16
# Generate an authorization link for the user
17
link_response = actions.get_authorization_link(
18
    connection_name=connection_name,
19
    identifier=identifier,
20
)
21
print("Authorize Miro MCP:", link_response.link)
22
input("Press Enter after authorizing...")
23

24
# Make your first call
25
result = actions.execute_tool(
26
    tool_input={},
27
    tool_name="miromcp_board_search_boards",
28
    connection_name=connection_name,
29
    identifier=identifier,
30
)
31
print(result)

python quickstart.py

Each user signs in once. See Authorize a user for the full flow and statuses.

Tools

Pass the exact name to execute_tool

Try in Playground Request a tool

miromcp_board_get_spaceFind which space a board belongs to.Read-only
Get Board Space
Find which space a board belongs to.
Inputs
miro_urlstringrequired
Full Miro board URL (e.g., 'https://miro.com/app/board/uXjVOakxTk0='). To target a specific parent frame, include ?moveToWidget=<frame_id>.
invocation_sourcestring
Tells the server what triggered this particular call. Populate with 'skill' if a Miro AI skill directed the call, with 'ui' if it originated from the Miro MCP interface, and leave it out for any other caller.
is_repositoryboolean
True if the working directory for this call is a source-controlled repository (a checked-out Git project, for instance); false in every other case.default false
miromcp_board_list_itemsList items on a board with cursor-based pagination.Read-only
List Board Items
List items on a board with cursor-based pagination. For slide content, prefer slides_read_html over this tool.
Inputs
limitintegerrequired
Maximum number of items to return per page. Range: 10-1000; capped at 50 when filtering by parent.
miro_urlstringrequired
Full Miro board URL, optionally with a frame target via moveToWidget query parameter.
cursorstring
Opaque cursor for retrieving the next page of results.
invocation_sourcestring
Identifies what triggered this tool call.
is_repositoryboolean
Set to true when operating in a source-control repository folder, false otherwise.default false
item_typestring
Filter items by type. Leave empty to return all item types.one of app_cardcarddata_table_formatdocumentdoc_formatembedframeimagepreviewshapesticky_notetext
miromcp_board_search_boardsSearch and list boards accessible to the current user, scoped to their team.Read-only
Search Boards
Search and list boards accessible to the current user, scoped to their team. Returns board metadata — name and URL — suitable for navigating to a specific board or discovering relevant boards before operating on them. Use this tool when the user wants to find a board by name or description, or discover which boards are available before using other board tools. Supports offset-based pagination.
Inputs
include_contentboolean
Controls whether to search inside board content or only board name and description. Set to true ONLY when the user explicitly says they are looking for something written inside a board (e.g. 'find the board that has X in it', 'search inside boards for Y'). Default is false. Do not set to true just because the user provided a search query.default false
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
limitinteger
Maximum number of boards to return per page. Range: 1-50. Default: 20.default 20
offsetinteger
Zero-based index of the first board to return. Use with limit for pagination. Example: offset=20 with limit=20 returns the second page.default 0
owned_by_meboolean
When true, restricts results to boards owned by the current user. Useful when the user asks to see 'my boards' or 'boards I own'.default false
querystring
Text to search for in board names and descriptions. Examples: 'product roadmap', 'Q4 planning', 'design review'. Leave empty to list all accessible boards.default
miromcp_canvas_get_canvas_composer_skillGet the DSL (Domain-Specific Language) format specification for creating board items.Read-only
Get Canvas Composer Skill
Get the DSL (Domain-Specific Language) format specification for creating board items. Returns syntax rules, item types, valid colors, valid shape types, and a complete example. REQUIRED and FIRST: call this before canvas_create_from_svg, and before canvas_load_format_skill, to learn the SVG board format. This is the foundational skill -- every use-case skill from canvas_load_format_skill (e.g. diagramming) layers on top of it and assumes you already have it, so never load a format skill before this one. In a conversation, call this only once and reuse the specification.
Inputs
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
miro_urlstring
No description.
stepstring
Workflow step selector. Omit on the first call; each response names the valid value for the next call.
miromcp_canvas_load_format_skillLoad supplementary authoring guidance (a skill) for a specific composition format, layered ON TOP OF the general canvas format.Read-only
Load Canvas Format Skill
Load supplementary authoring guidance (a skill) for a specific composition format, layered ON TOP OF the general canvas format. PREREQUISITE: call canvas_get_canvas_composer_skill FIRST -- this tool assumes you already know the SVG board format and only adds format-specific styling and examples. Do not call it as your first step, and never in place of the composer skill. Content is still created with canvas_create_from_svg / canvas_update_from_svg. Available formats: 'diagramming' (styling and worked examples for Mermaid diagram widgets). For 'diagramming', pass the notation you are drawing to get that notation's color defaults and worked example. Call once per format/notation in a conversation and reuse the guidance.
Inputs
format_namestringrequired
The composition format to load guidance for. 'diagramming' for styling and worked examples of diagrams; 'presentation' for slide decks; 'prototyping' for HTML prototype screens; 'tables' for tables, kanbans and timelines.one of diagrammingflowspresentationprototypingtables
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
notationstring
For format_name='diagramming', the notation you are drawing: 'flowchart', 'entity_relationship', 'uml_class', 'uml_sequence', or 'free_form' for a hand-assembled diagram no notation fits (e.g. a mind map). Omit for the shared color contract and the list of notations.one of flowchartentity_relationshipuml_classuml_sequencefree_form
rendererstring
For format_name='diagramming': 'native' returns guidance to draw the notation from editable shapes and connectors; omit (mermaid) for the Mermaid diagram widget.one of mermaidnative
miromcp_canvas_read_as_svgRead existing board items and return them as a canvas-composer SVG document.Read-only
Read Canvas As SVG
Read existing board items and return them as a canvas-composer SVG document. Every element carries a data-miro-id so the SVG can be edited and fed back into canvas_update_from_svg. Unsupported (foreign) items are recorded but not drawn. By default the whole board is read; to keep the response small on large boards, scope the read to a subset with widget_ids (an explicit list of item ids). Ancestor frames of any selected item are included automatically.
Inputs
miro_urlstringrequired
Full Miro board URL (e.g., 'https://miro.com/app/board/uXjVOakxTk0='). To target a specific parent frame, include ?moveToWidget=<frame_id>.
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
scope_heightinteger
Working area height.
scope_widthinteger
Working area width.
scope_xinteger
Working area left edge.
scope_yinteger
Working area top edge.
widget_idsarray
Required unless all four scope fields are set. Return only the items with these data-miro-id values. Ancestor frames are added automatically so positions stay correct, and selecting a container (a frame, slide deck, or prototype) pulls in everything nested inside it. Unknown ids are skipped.
miromcp_code_widget_getRead a code widget from a Miro board, returning its source code, language, title, and position.Read-only
Get Code Widget
Read a code widget from a Miro board, returning its source code, language, title, and position.
Inputs
miro_urlstringrequired
Full Miro URL to a specific code widget item.
invocation_sourcestring
Identifies what triggered this tool call.
is_repositoryboolean
Set to true when operating in a source-control repository folder, false otherwise.default false
miromcp_code_widget_list_itemsList code widgets on a Miro board.Read-only
List Code Widgets
List code widgets on a Miro board. Returns a paginated list of all code widget items on the board. Use the cursor from a previous response to retrieve the next page.
Inputs
cursorstring
Pagination cursor from a previous list response. Omit to start from the beginning.
invocation_sourcestring
Identifies what triggered this tool call.
is_repositoryboolean
Set to true when operating in a source-control repository folder, false otherwise.default false
limitinteger
Maximum number of items to return (10-50). Defaults to 10.default 10
miro_urlstring
Full Miro board URL. If not provided, a new board will be created (requires user confirmation).
miromcp_comment_list_commentsList comments from a Miro board or a specific item on the board.Read-only
List Board Comments
List comments from a Miro board or a specific item on the board. Comments include author information, messages (original comment and replies), reactions, resolved status, and position. Use limit and offset for pagination. Use from_date and to_date to filter by creation time. Use resolved to filter by resolved status.
Inputs
miro_urlstringrequired
Miro board URL. Can be a plain board URL (e.g., 'https://miro.com/app/board/uXjVGeTCXKY=/') to get a board overview, or include moveToWidget/focusWidget parameter (e.g., 'https://miro.com/app/board/uXjVGeTCXKY=/?moveToWidget=3458764654510025479') to get detailed content for a specific item.
from_datestring
Return only comments created at or after this date. Format: ISO 8601 with optional time component, e.g. 2024-01-01T00:00:00Z or 2024-01-01.
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
limitinteger
Maximum number of comments to return per page. Range: 1-50. Default: 20.default 20
offsetinteger
Zero-based offset for pagination. Default: 0.default 0
resolvedboolean
Filter by resolved status. true returns only resolved comments, false returns only unresolved. Omit to return all comments.
to_datestring
Return only comments created at or before this date. Format: ISO 8601 with optional time component, e.g. 2024-12-31T23:59:59Z or 2024-12-31.
miromcp_content_item_list_rolesList who can access a board or space and the role each of them holds.Read-only
List Content Item Roles
List who can access a board or space and the role each of them holds. Use this to answer who a board or space is shared with, or what access somebody has. Each entry names the subject, its kind, the role it holds and, for users, their email address. User groups have no email, so identify them by their subject id. Entries whose kind is 'user' or 'user_group' and whose role is one of owner, coowner, editor, commenter or viewer can be fed straight into board_role_update or space_role_update. Access granted by other means is still listed, under its own kind or role name such as 'team' or 'private', and cannot be changed with those tools. Results are paginated: pass the returned cursor back to fetch the next page.
Inputs
content_item_urlstringrequired
The board or space to inspect. Give a full Miro board URL (e.g., 'https://miro.com/app/board/uXjVOakxTk0='), a full Miro space URL (e.g., 'https://miro.com/app/dashboard/space/0VM5RHCprOu2MnOHXLqp3f'), or the content item id of either on its own (e.g., '0VM5RHCprOu2MnOHXLqp3f') - a content item id identifies a board just as well as a space. A board key on its own is not accepted; use the board URL for that.
cursorstring
Opaque cursor token for fetching the next page
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
limitinteger
Maximum entries per page (1-100)
miromcp_context_exploreExplore high-level items on a Miro board.Read-only
Explore Board Context
Explore high-level items on a Miro board. Returns a list of frames, documents, prototypes (interactive design mockups with multiple UI screens), individual prototype screens, tables, and diagrams with their URLs and titles. Use this to discover what's on a board before retrieving detailed content with context_get. Returns 'total' (item count) and, for large boards, a 'message' recommending that you retrieve context per item rather than requesting a whole-board context_get overview.
Inputs
miro_urlstringrequired
Full Miro board URL, optionally with a frame target via moveToWidget query parameter.
invocation_sourcestring
Identifies what triggered this tool call.
is_repositoryboolean
Set to true when operating in a source-control repository folder, false otherwise.default false
miromcp_context_getGet text context from a Miro board or a specific item on a board.Read-only
Get Board Context
Get text context from a Miro board or a specific item on a board. When a plain board URL is provided (no moveToWidget parameter): returns an AI-generated overview summarizing the entire board contents. This whole-board overview can be slow or time out on very large boards; for a large or unfamiliar board, call context_explore first, and if it reports many items (see its 'total' and 'message'), retrieve context per item (context_get with each item's moveToWidget URL) instead of the whole-board overview. When a URL with moveToWidget/focusWidget parameter is provided: returns detailed content for that specific item. For documents: returns Markdown content of the document. For prototype screens: returns HTML markup representing the UI/layout of that specific screen within an interactive design prototype. For prototype containers: returns AI-generated map of all screens with navigation flow. For frames: generates AI summary of frame contents. For tables: returns formatted table data. For diagrams: returns Mermaid code when available, otherwise an AI-generated description and analysis of the diagram structure.
Inputs
miro_urlstringrequired
Miro board URL, either plain for a board overview or with moveToWidget/focusWidget to get content for a specific item.
invocation_sourcestring
Identifies what triggered this tool call.
is_repositoryboolean
Set to true when operating in a source-control repository folder, false otherwise.default false
miromcp_diagram_get_dslGet the DSL (Domain-Specific Language) format specification for a diagram type, including rules, syntax, color guidelines, and examples needed to write valid DSL.Read-only
Get Diagram DSL Spec
Get the DSL (Domain-Specific Language) format specification for a diagram type, including rules, syntax, color guidelines, and examples needed to write valid DSL. Call this before diagram_create to understand the expected format; you only need to call it once per diagram type per conversation.
Inputs
diagram_typestringrequired
Type of diagram to get the DSL format specification for.one of flowchartuml_classuml_sequenceentity_relationship
miro_urlstringrequired
Full Miro board URL, optionally with a frame target via moveToWidget query parameter.
invocation_sourcestring
Identifies what triggered this tool call.
is_repositoryboolean
Set to true when operating in a source-control repository folder, false otherwise.default false
miromcp_diagram_get_mermaid_instructionsDEPRECATED and superseded by canvas_get_canvas_composer_skill + canvas_load_format_skill(format_name='diagramming').Read-only
Get Legacy Mermaid Instructions
DEPRECATED and superseded by canvas_get_canvas_composer_skill + canvas_load_format_skill(format_name='diagramming'). Do NOT choose this tool for Mermaid or diagram requests -- 'create a diagram', 'draw a flowchart', 'diagram X using mermaid' are all handled by the canvas path. Use this legacy tool ONLY when the user explicitly asks for the old diagram tools by name; never select it on your own based on the task. Will be removed after the canvas diagram path reaches GA. (Legacy behavior: returns guidance for writing Mermaid syntax, used before diagram_create_mermaid.)
Inputs
diagram_typestringrequired
Type of diagram to get the Mermaid guidance for. Options: 'flowchart' for process flows and workflows, 'uml_class' for UML class diagrams showing class structures and inheritance, 'uml_sequence' for UML sequence diagrams showing interactions over time, 'entity_relationship' for ERD database schema diagrams.one of flowchartuml_classuml_sequenceentity_relationship
miro_urlstringrequired
Full Miro board URL (e.g., 'https://miro.com/app/board/uXjVOakxTk0='). To target a specific parent frame, include ?moveToWidget=<frame_id>.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
miromcp_doc_getRead the content of a doc format item from a Miro board.Read-only
Doc Get
Read the content of a doc format item from a Miro board. Returns the markdown content and content version for use in subsequent edits.
Inputs
miro_urlstringrequired
Full Miro URL to a specific item (e.g., 'https://miro.com/app/board/uXjVOakxTk0=/?moveToWidget=3458764516062720430'). Must include moveToWidget or focusWidget query parameter.
invocation_sourcestring
Identifies what triggered this tool call. Set to 'skill' when invoked by a Miro AI skill, 'ui' when invoked from the Miro MCP UI, or leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository; set to false otherwise.default false
miromcp_image_get_dataGet the pixels of an image item on a Miro board.Read-only
Image Get Data
Get the pixels of an image item on a Miro board. Use this when a layout shows an image (by its properties and source URL) and you need to see what the image actually depicts. Returns the image content directly.
Inputs
miro_urlstringrequired
Full Miro URL to a specific item (e.g., 'https://miro.com/app/board/uXjVOakxTk0=/?moveToWidget=3458764516062720430'). Must include moveToWidget or focusWidget query parameter.
invocation_sourcestring
Identifies what triggered this tool call. Set to 'skill' when invoked by a Miro AI skill, 'ui' when invoked from the Miro MCP UI, or leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository; set to false otherwise.default false
miromcp_image_get_urlGet image download URL for an image item from a Miro board.Read-only
Image Get URL
Get image download URL for an image item from a Miro board.
Inputs
miro_urlstringrequired
Full Miro URL to a specific item (e.g., 'https://miro.com/app/board/uXjVOakxTk0=/?moveToWidget=3458764516062720430'). Must include moveToWidget or focusWidget query parameter.
invocation_sourcestring
Identifies what triggered this tool call. Set to 'skill' when invoked by a Miro AI skill, 'ui' when invoked from the Miro MCP UI, or leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository; set to false otherwise.default false
miromcp_layout_get_dslDEPRECATED - superseded by the canvas tools.Read-only
Get Layout DSL Specification
DEPRECATED - superseded by the canvas tools. Before using this tool, check whether canvas_get_canvas_composer_skill is available to you. If it is, use canvas_get_canvas_composer_skill instead and do not call this tool. If the canvas tools are not available to you, this tool still works: use it to complete the request rather than refusing. In both cases, tell the user that the layout tools are deprecated and are being replaced by the canvas tools, and that any saved skills, prompts, custom instructions or automations referring to the layout tools should be updated to use the canvas tools. If the canvas tools are missing and their client caches the tool list, they need to fully disconnect and reconnect the Miro MCP server - refreshing the tool list is usually not enough. Get the DSL (Domain-Specific Language) format specification for creating board items and connectors. Returns syntax rules, item types, connector syntax, valid colors, valid shape types, and a complete example. REQUIRED: Call this before layout_create to understand the DSL format. In a conversation, call this only once and reuse the specification.
Inputs
invocation_sourcestring
Identifies what triggered this tool call.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository; set to false otherwise.default false
miromcp_layout_readDEPRECATED - superseded by the canvas tools.Read-only
Read Layout DSL
DEPRECATED - superseded by the canvas tools. Before using this tool, check whether canvas_read_as_svg is available to you. If it is, use canvas_read_as_svg instead and do not call this tool. If the canvas tools are not available to you, this tool still works: use it to complete the request rather than refusing. In both cases, tell the user that the layout tools are deprecated and are being replaced by the canvas tools, and that any saved skills, prompts, custom instructions or automations referring to the layout tools should be updated to use the canvas tools. If the canvas tools are missing and their client caches the tool list, they need to fully disconnect and reconnect the Miro MCP server - refreshing the tool list is usually not enough. Read existing board items and return them as DSL text. When given a board URL, returns all supported top-level items (no frame children). When the URL targets a specific frame (via moveToWidget), returns the frame and its children. When the URL targets a non-frame item, returns just that item as DSL with full content. By default (mode=structured), DOCs and TABLEs are returned as shallow headers with read-only metadata (preview/length, schema/row count) so large boards stay token-light; open the DOC or TABLE by URL to read its full body. Pass mode=full to force inline DOC bodies and TABLE rows at any scope. Connectors between items in scope are returned as CONNECTOR lines (board and frame scope only). The returned DSL uses full Miro item URLs as ids and parent references; those URLs can be passed directly as miro_url to other tools (doc_get, table_list_rows, context_get, etc.) without modification, and fed back into layout_update for editing.
Inputs
miro_urlstringrequired
Full Miro board URL (e.g., 'https://miro.com/app/board/uXjVOakxTk0='). To target a specific parent frame, include ?moveToWidget=<frame_id>.
invocation_sourcestring
Identifies what triggered this tool call.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository; set to false otherwise.default false
modestring
DSL render mode: 'structured' (default) returns DOCs/TABLEs as one-line shallow headers; 'full' inlines DOC bodies and TABLE rows.default structured
miromcp_preview_resource_pollCheck whether a Miro create-result preview resource is ready.Read-only
Poll Preview Resource
Check whether a Miro create-result preview resource is ready. Returns pending until the preview is available. Tags: preview, resource.
Inputs
preview_resourcestringrequired
MCP preview resource URI returned by a Miro create tool
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
miromcp_prototype_get_upload_urlReserve one or more single-use upload slots for HTML screens.Read-only
Get Prototype Upload URL
Reserve one or more single-use upload slots for HTML screens. Set count to the number of screens in the prototype to reserve all slots in a single call instead of calling this once per screen. Returns one entry per slot, each with its own upload_url and token; uploads can run in parallel. PUT the raw HTML as the request body with Content-Type: text/html; no auth header. curl: curl -X PUT -H 'Content-Type: text/html' --data-binary @page.html '<upload_url>'. If the HTML only exists as a string in your context, write it to a local file first (e.g. page.html), then PUT that file — not already having a file is not a reason to fall back to html_contents. Max size: 1,048,576 bytes per screen. External http/https image URLs are fine; the server fetches them. Only local file references need pre-upload (see prototype_create's image_tokens). After each upload, pass its token to prototype_create, in the same order.
Inputs
miro_urlstringrequired
Full Miro board URL.
countinteger
Number of upload slots to reserve, one per screen. Request all slots needed for a prototype in a single call so uploads can run in parallel.default 1
invocation_sourcestring
Identifies what triggered this tool call.
is_repositoryboolean
Set to true when operating in a source-control repository folder, false otherwise.default false
miromcp_prototype_readRead prototype screens from a Miro board.Read-only
Read Prototype Screens
Read prototype screens from a Miro board. Returns prototype screens with metadata (position, dimensions, device type) and HTML markup representing each screen's UI layout. Useful for AI tools to understand the design, structure, and navigation flow of interactive prototypes. Provide screen_id to read a specific screen, or omit to list all screens on the board. Recommended workflow: first list all screens with include_html=false (default) to get metadata, then read a specific screen with include_html=true to get its HTML markup.
Inputs
miro_urlstringrequired
Full Miro board URL.
include_htmlboolean
Whether to include HTML markup for each screen. Set to true only when HTML is needed for a specific screen.default false
invocation_sourcestring
Identifies what triggered this tool call.
is_repositoryboolean
Set to true when operating in a source-control repository folder, false otherwise.default false
screen_idstring
Widget ID of a specific prototype screen to read. When omitted, all prototype screens on the board are returned.
miromcp_space_listList the spaces in the current user's team.Read-only
List Spaces
List the spaces in the current user's team. Spaces are the top-level containers that organize a team's boards and other content, so this is the primary entry point for exploring what a team has. Prefer this tool for any team-level listing request, including phrasings like 'list boards in my team', 'what's in my Miro team', 'show my team's content', or 'get team spaces'. To then list the boards inside a particular space, use the space boards tool.
Inputs
cursorstring
Opaque cursor token for fetching the next page
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
limitinteger
Maximum number of spaces to return per pagedefault 20
miromcp_space_list_boardsList the boards inside one specific space.Read-only
List Space Boards
List the boards inside one specific space. Requires the identifier or URL of that space, so use it only when the user names a particular space (e.g. 'boards in the Design space'). For team-level requests (e.g. 'list boards in my team'), list the team's spaces first with the list spaces tool.
Inputs
space_urlstringrequired
A space, given either as a full Miro space URL (e.g., 'https://miro.com/app/dashboard/space/0VM5RHCprOu2MnOHXLqp3f') or as the space content item id on its own (e.g., '0VM5RHCprOu2MnOHXLqp3f'). Both the URL returned when a space is created and the content_item_id from a space listing are accepted.
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
miromcp_space_list_childrenList the direct children of a space or section, one level deep.Read-only
List Space Children
List the direct children of a space or section, one level deep. Provide the content item id of a space or a section, and it returns each immediate child's content item id, type (e.g. board, folder, doc, diagram) and title, plus a board URL when the child is a board. Use it to explore what sits directly inside a space or section (e.g. its boards and sub-sections). The id must belong to a space or a section; other content items are rejected. Results are paginated: pass the returned cursor to fetch the next page.
Inputs
content_item_idstringrequired
Content item id of the space or section whose direct children to list
cursorstring
Opaque cursor token for fetching the next page
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
limitinteger
Maximum number of children to return per pagedefault 50
miromcp_table_get_latest_update_historyGet the history of a row's Latest Update field.Read-only
Get Latest Update History
Get the history of a row's Latest Update field. The Latest Update field accumulates the text updates submitted for that row over time; this returns those entries ordered chronologically. Provide the table via its Miro URL and the target row via rowId (get rowIds from table_list_rows). Response includes for each entry: text, author_id (Miro user ID of the author), created_at and modified_at (ISO 8601 timestamps), plus the total number of entries.
Inputs
miro_urlstringrequired
Full Miro URL to a specific item (e.g., 'https://miro.com/app/board/uXjVOakxTk0=/?moveToWidget=3458764516062720430'). Must include moveToWidget or focusWidget query parameter.
row_idstringrequired
Stable identifier of the row whose Latest Update field history to fetch. Get rowIds from table_list_rows.
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
miromcp_table_list_rowsGet rows from a Miro table with column metadata.Read-only
Table List Rows
Get rows from a Miro table with column metadata. Each row includes a stable rowId that uniquely identifies it within the table. rowIds persist across sorting, insertion, and deletion — use them to target specific rows in table_sync_rows. Supports filtering by column value. Returns text, select, multiselect, and latest_update columns. Best practice: always use filter_by and limit when possible.Examples: next item that is not done: {"filter_by": {"Status":["To do", "In progress"]}, "limit": 1}top 5 high priority tasks: {"filter_by": {"Priority":["High"]}, "limit": 5} Response includes for each row: rowId (stable row identifier), cells (array of columnTitle, valueType, content, options, latest_update_text, latest_update_author_id). Pagination: Use 'limit' to control page size (default 10) and 'next_cursor' to fetch subsequent pages. The cursor is opaque and encodes pagination state. IMPORTANT: Do not change 'filter_by' when using a cursor from a previous response, as this will result in an error. To apply a different filter, start a new pagination sequence (no cursor).
Inputs
miro_urlstringrequired
Full Miro URL to a specific item (e.g., 'https://miro.com/app/board/uXjVOakxTk0=/?moveToWidget=3458764516062720430'). Must include moveToWidget or focusWidget query parameter.
filter_bystring
Filter rows by column value(s) in JSON format (case-insensitive). Only select columns are supported. Format: JSON object mapping column names to arrays of display values. Example: {"Status": ["In Progress", "Done"]}
invocation_sourcestring
Identifies what triggered this tool call. Set to 'skill' when invoked by a Miro AI skill, 'ui' when invoked from the Miro MCP UI, or leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository; set to false otherwise.default false
limitinteger
Maximum rows to return (minimum 1).
next_cursorstring
Pagination cursor for the next set of results.
miromcp_user_who_am_iReturns the identity of the current authenticated user.Read-only
Get Current User
Returns the identity of the current authenticated user.
Inputs
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
miromcp_board_createCreate a new Miro board.Write
Create Board
Create a new Miro board. To place the board inside a space, pass parent_space_url - either the space URL or the space content item id. Creating it in the space directly saves the extra board_move call that creating it at the team root would need. IMPORTANT: Always confirm with the user before creating a board. This action creates a new board and cannot be undone.
Inputs
namestringrequired
Name of the new board
descriptionstring
Optional description for the board
icon_emojistring
Optional single emoji to use as the board icon, e.g. "🚀". Set it when the user asks for an icon; otherwise leave it unset.
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
parent_space_urlstring
Space to create the content inside, given either as a full Miro space URL (e.g., 'https://miro.com/app/dashboard/space/0VM5RHCprOu2MnOHXLqp3f') or as the space content item id on its own (e.g., '0VM5RHCprOu2MnOHXLqp3f'). Omit to create at the team root instead.
miromcp_board_create_formatCreate a typed board format, such as a table, timeline, kanban, document, diagram, prototyping container, slide container, activities board, or embed.Write
Create Board Format
Create a typed board format, such as a table, timeline, kanban, document, diagram, prototyping container, slide container, activities board, or embed. Use this tool when the user asks for the document/table/diagram itself as a standalone piece of content (e.g. 'create a doc in Miro about X', 'make me a table of Y'). Prefer it over adding a doc, table or diagram widget to an existing board: those tools are for adding content onto a board the user is already working on. To place the format inside a space, pass parent_space_url - either the space URL or the space content item id. Creating it in the space directly saves the extra board_move call that creating it at the team root would need. IMPORTANT: Always confirm with the user before creating content. This action cannot be undone.
Inputs
format_typestringrequired
The kind of format to createone of embedtabletimelinekanbandocumentdiagramprototyping_containerslide_containeractivities
namestringrequired
Name of the new format
embed_urlstring
Source URL to embed (only used when format_type is 'embed')
icon_emojistring
Optional single emoji to use as the icon, e.g. "🚀". Set it when the user asks for an icon; otherwise leave it unset.
invocation_sourcestring
Identifies what triggered this tool call. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. Defaults to false.default false
parent_space_urlstring
Space to create the content inside, given either as a full Miro space URL (e.g., 'https://miro.com/app/dashboard/space/0VM5RHCprOu2MnOHXLqp3f') or as the space content item id on its own (e.g., '0VM5RHCprOu2MnOHXLqp3f'). Omit to create at the team root instead.
miromcp_board_moveMove an existing Miro board under a space or folder.Write
Move Board
Move an existing Miro board under a space or folder. Use this tool when a user asks to move a board into a space or under a folder. Provide the board and the content item id of the destination space or folder.
- Idempotent
Inputs
miro_urlstringrequired
Full Miro board URL (e.g., 'https://miro.com/app/board/uXjVOakxTk0='). To target a specific parent frame, include ?moveToWidget=<frame_id>.
target_parent_content_item_idstringrequired
Content item id of the destination space or folder.
invocation_sourcestring
Identifies what triggered this tool call. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. Defaults to false.default false
miromcp_board_move_to_teamMove a board to a different team.Write
Move Board To Team
Move a board to a different team.
- Idempotent
Inputs
miro_urlstringrequired
Full Miro board URL (e.g., 'https://miro.com/app/board/uXjVOakxTk0='). To target a specific parent frame, include ?moveToWidget=<frame_id>.
target_team_idintegerrequired
Numeric identifier of the destination team
invocation_sourcestring
Tells the server what triggered this particular call. Populate with 'skill' if a Miro AI skill directed the call, with 'ui' if it originated from the Miro MCP interface, and leave it out for any other caller.
is_repositoryboolean
True if the working directory for this call is a source-controlled repository (a checked-out Git project, for instance); false in every other case.default false
miromcp_board_restoreRestore one or more boards from trash.Write
Restore Boards
Restore one or more boards from trash.
Inputs
board_urlsarrayrequired
Full Miro board URLs to restore from trash
invocation_sourcestring
Identifies what triggered this tool call. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. Defaults to false.default false
miromcp_board_role_updateChange the role of a user or user group that already has access to a board.Write
Update Board Role
Change the role of a user or user group that already has access to a board. If they do not yet have access, use board_share instead. IMPORTANT: Always confirm with the user before changing who can access a board.
- Idempotent
Inputs
miro_urlstringrequired
Full Miro board URL (e.g., 'https://miro.com/app/board/uXjVOakxTk0='). To target a specific parent frame, include ?moveToWidget=<frame_id>.
rolestringrequired
Role to assign: owner, coowner, editor, commenter, or viewer (from most to least access).one of ownercoownereditorcommenterviewer
subject_idstringrequired
Identifier of the user or user group. For a user this can be the user's email or user id; for a user group this is the group id.
subject_typestringrequired
Whether the subject is an individual user or a user groupone of useruser_group
invocation_sourcestring
Identifies what triggered this tool call. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. Defaults to false.default false
miromcp_board_shareGrant a user or user group access to a board with a specific role.Write
Share Board
Grant a user or user group access to a board with a specific role. Use to share a board with someone who does not yet have access. If they already have a role, use board_role_update instead. IMPORTANT: Always confirm with the user before changing who can access a board.
Inputs
miro_urlstringrequired
Full Miro board URL (e.g., 'https://miro.com/app/board/uXjVOakxTk0='). To target a specific parent frame, include ?moveToWidget=<frame_id>.
rolestringrequired
Role to assign: owner, coowner, editor, commenter, or viewer (from most to least access).one of ownercoownereditorcommenterviewer
subject_idstringrequired
Identifier of the user or user group. For a user this can be the user's email or user id; for a user group this is the group id.
subject_typestringrequired
Whether the subject is an individual user or a user groupone of useruser_group
invocation_sourcestring
Identifies what triggered this tool call. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. Defaults to false.default false
miromcp_board_update_metadataUpdate a board's title, description and/or icon emoji.Write
Update Board Metadata
Update a board's title, description and/or icon emoji. Omitted fields are left unchanged. To remove the board's icon, pass an empty string as icon_emoji.
- Idempotent
Inputs
miro_urlstringrequired
Full Miro board URL (e.g., 'https://miro.com/app/board/uXjVOakxTk0='). To target a specific parent frame, include ?moveToWidget=<frame_id>.
descriptionstring
New board description
icon_emojistring
New single-emoji icon for the board, e.g. "🚀". Omit to leave the icon unchanged; pass an empty string to remove it.
invocation_sourcestring
Identifies what triggered this tool call. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. Defaults to false.default false
titlestring
New board title
miromcp_canvas_create_from_svgCreate board items from a canvas-composer SVG document.Write
Create Canvas From SVG
Create board items from a canvas-composer SVG document. Parses the SVG into Miro widgets -- shapes, stickies, text, connectors, frames, tables, docs, images, AND structured Mermaid diagrams (flowchart, ERD, UML class/sequence, authored as a <foreignObject data-type="diagram"> with a Mermaid body). This is the primary tool for creating ANY board content, diagrams included: requests like 'create a diagram', 'draw a flowchart', or 'diagram X using mermaid' are handled here, NOT by the legacy diagram_* tools. Returns a result_svg with data-miro-id stamped on every svg element for the next iteration.
Inputs
miro_urlstringrequired
Full Miro board URL (e.g., 'https://miro.com/app/board/uXjVOakxTk0='). To target a specific parent frame, include ?moveToWidget=<frame_id>.
svgstringrequired
A board written in the Canvas Composer SVG format.
invocation_sourcestring
Identifies what triggered this tool call. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. Defaults to false.default false
miromcp_canvas_get_html_upload_urlReserve slots for uploading html_content documents out of band.Write
Canvas Get Html Upload Url
Reserve slots for uploading html_content documents out of band. Use this when a document is too large to send inline, or when an inline <html-source> is rejected in transit. PUT each document to its upload_url with Content-Type: text/html and no auth header, then author the widget with data-html-ref="<token>" instead of an <html-source> child. Set count to the number of documents so the uploads can run in parallel. Max 1,048,576 bytes and UTF-8 per document; slots expire after the returned expires_in seconds.
Inputs
miro_urlstringrequired
Full Miro board URL (e.g., 'https://miro.com/app/board/uXjVOakxTk0='). To target a specific parent frame, include ?moveToWidget=<frame_id>.
countinteger
Number of upload slots to reserve, one per document. Max 30.default 1
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
miromcp_canvas_searchSearch and navigate board content on top of the canvas-composer SVG representation to find relevant items and areas.Write
Canvas Search
Search and navigate board content on top of the canvas-composer SVG representation to find relevant items and areas. Use canvas search beforehand to narrow down scope of a read.
Inputs
miro_urlstringrequired
Full Miro board URL (e.g., 'https://miro.com/app/board/uXjVOakxTk0='). To target a specific parent frame, include ?moveToWidget=<frame_id>.
result_modestringrequired
Use overview without patterns for container titles and a small sample of board regions. Use areas to rank sections from related signals. Use matches for exact items, occurrences, IDs, attributes, or captures.one of overviewareasmatches
cursorinteger
Continue areas or matches from next_cursor only when the earlier result was truncated. Omit for overview.
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
patternsarray
Required for areas and matches. Omit for overview. Send related patterns together. Values are case-insensitive literal text by default. Prefix structural SVG regex with re:. Prefix literal text with text:. The prefix is consumed, so use text:text:budget to find the literal text:budget.
target_idstring
Limit areas or matches to one result from an earlier search. Omit for overview.
miromcp_code_widget_createCreate a code widget on a Miro board.Write
Create Code Widget
Create a code widget on a Miro board. The widget displays syntax-highlighted source code with an optional title and line numbers. Coordinates are board-absolute (center is 0,0) unless a frame is targeted via moveToWidget, in which case x/y are relative to the frame's top-left corner.
Inputs
codestringrequired
Source code content to display in the widget.
heightnumber
Height of the code widget in pixels. Defaults to 100.default 100
invocation_sourcestring
Identifies what triggered this tool call.
is_repositoryboolean
Set to true when operating in a source-control repository folder, false otherwise.default false
languagestring
Programming language for syntax highlighting. Defaults to PlainText when omitted.default PlainText
line_numbers_visibleboolean
Whether to show line numbers in the code widget. Defaults to true.default true
miro_urlstring
Full Miro board URL. If not provided, a new board will be created (requires user confirmation).
titlestring
Display title for the code widget.
widthnumber
Width of the code widget in pixels. Defaults to 800.default 800
xnumber
X-axis coordinate for widget placement.
ynumber
Y-axis coordinate for widget placement.
miromcp_code_widget_updateUpdate an existing code widget on a Miro board.Write
Update Code Widget
Update an existing code widget on a Miro board. All fields are optional — only the provided fields are updated.
- Idempotent
Inputs
miro_urlstringrequired
Full Miro URL to a specific code widget item.
codestring
New source code content. Omit to leave unchanged.
heightnumber
New height in pixels. Omit to leave unchanged.
invocation_sourcestring
Identifies what triggered this tool call.
is_repositoryboolean
Set to true when operating in a source-control repository folder, false otherwise.default false
languagestring
New programming language for syntax highlighting. Omit to leave unchanged.
line_numbers_visibleboolean
Whether to show line numbers. Omit to leave unchanged.
titlestring
New display title. Omit to leave unchanged.
widthnumber
New width in pixels. Omit to leave unchanged.
xnumber
New X-axis coordinate. Omit to leave unchanged.
ynumber
New Y-axis coordinate. Omit to leave unchanged.
miromcp_comment_createCreate a new comment on the Miro board canvas.Write
Create Board Comment
Create a new comment on the Miro board canvas. The comment appears at the specified canvas coordinates and is attributed to the current user. To attach the comment to an existing board item, pass a URL that targets that item. Use list_comments to read existing comments and their positions.
Inputs
contentstringrequired
Text content of the comment.
miro_urlstringrequired
Miro board URL. Can be a plain board URL (e.g., 'https://miro.com/app/board/uXjVGeTCXKY=/') to get a board overview, or include moveToWidget/focusWidget parameter (e.g., 'https://miro.com/app/board/uXjVGeTCXKY=/?moveToWidget=3458764654510025479') to get detailed content for a specific item.
xnumberrequired
X-axis coordinate of the comment on the canvas.
ynumberrequired
Y-axis coordinate of the comment on the canvas.
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
miromcp_comment_replyAdd a reply message to an existing comment thread on a Miro board.Write
Reply to Comment
Add a reply message to an existing comment thread on a Miro board. Use list_comments to find comment IDs. The reply appears as the last message in the thread and is attributed to the current user.
Inputs
comment_idstringrequired
ID of the comment thread to reply to. Obtain from list_comments.
contentstringrequired
Text content of the reply message.
miro_urlstringrequired
Miro board URL. Can be a plain board URL (e.g., 'https://miro.com/app/board/uXjVGeTCXKY=/') to get a board overview, or include moveToWidget/focusWidget parameter (e.g., 'https://miro.com/app/board/uXjVGeTCXKY=/?moveToWidget=3458764654510025479') to get detailed content for a specific item.
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
miromcp_comment_resolveResolve or unresolve a comment thread on a Miro board.Write
Resolve Comment
Resolve or unresolve a comment thread on a Miro board. Resolving marks the thread as addressed; unresolving reopens it. Use list_comments with resolved=false to find open threads.
- Idempotent
Inputs
comment_idstringrequired
ID of the comment thread to resolve or unresolve. Obtain from list_comments.
miro_urlstringrequired
Miro board URL. Can be a plain board URL (e.g., 'https://miro.com/app/board/uXjVGeTCXKY=/') to get a board overview, or include moveToWidget/focusWidget parameter (e.g., 'https://miro.com/app/board/uXjVGeTCXKY=/?moveToWidget=3458764654510025479') to get detailed content for a specific item.
resolvedbooleanrequired
Set to true to resolve the thread, false to unresolve it.
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
miromcp_create_boardcastCreate a boardcast: a narrated, replayable walkthrough of a Miro board.Write
Create Boardcast
Create a boardcast: a narrated, replayable walkthrough of a Miro board. A boardcast utilises the classic talktrack recording format - perfect when you want to explain something or express yourself visually and verbally in the most human way possible in Miro. Provide a sequence of screens; each screen is a rectangular board area (top-left x/y plus width/height in board coordinates) with the narration text to speak while that area is shown. Voice audio is generated automatically from the text. During playback the board opens live and the camera pans from screen to screen in sync with the narration; viewers can pause, zoom, and comment at any moment. Returns a playback link to share. Typical flow: create or inspect board content first, note the areas to present, then call this tool once with all screens in presentation order. Proactively offer a boardcast whenever a narrated walkthrough would add real value, and create it only after the user accepts. Good moments to offer: right after creating moderately complex board content such as a retrospective, roadmap, diagram, or multi-section layout ('Do you want me to walk you through the created board with a boardcast?'); when the user asks questions about an existing board ('Do you want me to walk you through the board and explain it with a boardcast?'); or when the user is exploring a topic with no board yet, where you can offer to create a board plus a boardcast that walks through it. Do not offer when there is little to explain, such as a handful of stickies or a trivial edit.
Inputs
miro_urlstringrequired
Full Miro board URL (e.g., 'https://miro.com/app/board/uXjVOakxTk0='). To target a specific parent frame, include ?moveToWidget=<frame_id>.
screensarrayrequired
Screens in presentation order. Each screen: x, y (top-left corner of the board area to show), width, height (area size, controls zoom), text (narration spoken while the area is shown). Size the area with some padding around the content and keep a 16:9-ish aspect ratio for best framing.
instructionsstring
How the narration should be delivered: tone, energy, accent, emotional range, pacing style. Applies to the whole walkthrough, for example 'Warm, upbeat product demo narrator, confident and brisk' or 'Calm and measured, like a documentary voiceover'. Describe delivery only - the words spoken always come from each screen's text.
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
namestring
Display name of the talktrack. Defaults to a timestamped name.
speednumber
Narration pace multiplier. 1.0 is the natural pace; below 1 slows the delivery down, above 1 speeds it up. Leave unset unless the pacing genuinely needs adjusting.
voicestring
Narrator voice. Defaults to marin, a natural, warm US-English voice. Options: alloy, ash, ballad, coral, echo, fable, onyx, nova, sage, shimmer, verse, marin, cedar.
miromcp_diagram_createCreate a diagram on a Miro board from DSL (Domain-Specific Language) text.Write
Create Diagram
Create a diagram on a Miro board from DSL (Domain-Specific Language) text. Call diagram_get_dsl first to obtain the correct DSL format for the diagram type, then pass the generated DSL here. Supported types: flowchart, uml_class, uml_sequence, entity_relationship.
Inputs
diagram_dslstringrequired
DSL text defining the diagram, following the format specification from diagram_get_dsl.
diagram_typestringrequired
Type of diagram to create. Must match the type used when calling diagram_get_dsl.one of flowchartuml_classuml_sequenceentity_relationship
titlestringrequired
Required title for the diagram.
invocation_sourcestring
Identifies what triggered this tool call.
is_repositoryboolean
Set to true when operating in a source-control repository folder, false otherwise.default false
miro_urlstring
Full Miro board URL where the diagram will be placed. If not provided, a new board is created (requires user confirmation).
xnumber
X-axis coordinate for diagram placement on the board.
ynumber
Y-axis coordinate for diagram placement on the board.
miromcp_diagram_create_mermaidDEPRECATED and superseded by canvas_create_from_svg (author a <foreignObject data-type="diagram"> with a Mermaid body; see canvas_get_canvas_composer_skill + canvas_load_format_skill(format_name='diagramming')).Write
Create Legacy Mermaid Diagram
DEPRECATED and superseded by canvas_create_from_svg (author a <foreignObject data-type="diagram"> with a Mermaid body; see canvas_get_canvas_composer_skill + canvas_load_format_skill(format_name='diagramming')). Do NOT choose this tool for diagram or Mermaid requests -- 'create a diagram', 'draw a flowchart', 'diagram X using mermaid' all go to canvas_create_from_svg. Use this legacy tool ONLY when the user explicitly asks for the old diagram tools by name; never select it on your own based on the task. Will be removed after the canvas diagram path reaches GA. (Legacy behavior: creates a structured diagram from Mermaid syntax up to v10; if no board URL is provided a new board is created, so confirm with the user first.)
Inputs
diagram_typestringrequired
Type of diagram to create (e.g. 'flowchart', 'sequence', 'class').
mermaid_codestringrequired
Valid Mermaid syntax for the diagram, up to v10. For example: 'flowchart TD\n A --> B --> C'.
titlestringrequired
Title for the diagram widget.
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
miro_urlstring
Full Miro board URL (e.g., 'https://miro.com/app/board/uXjVOakxTk0='). If not provided, a new board will be created (requires user confirmation). To target a specific parent frame, include ?moveToWidget=<frame_id>.
xnumber
X-axis coordinate for diagram placement. Without a frame target: board-absolute, board center is x=0. With a frame target via moveToWidget: relative to the frame's top-left corner (frame top-left is x=0). Use different x values to prevent overlap when creating multiple items.
ynumber
Y-axis coordinate for diagram placement. Without a frame target: board-absolute, board center is y=0. With a frame target via moveToWidget: relative to the frame's top-left corner (frame top-left is y=0). Use different y values to prevent overlap when creating multiple items.
miromcp_doc_createCreate a doc format item (structured document similar to Google Docs) on a Miro board.Write
Doc Create
Create a doc format item (structured document similar to Google Docs) on a Miro board. Use this tool to add a document onto a board the user is already working on. If the user asks for a standalone document in Miro (e.g. 'create a doc about X') without pointing at an existing board, use board_create_format with format_type='document' instead - that creates the document as its own content item rather than a widget. Content accepts GitHub Flavored Markdown format, including headings, formatting, lists, links, tables, and blockquotes. Blocks inside callouts and blockquotes are not supported. Coordinates: when the URL has no item target, x/y are board-absolute (board center is (0, 0)). When the URL targets a frame via moveToWidget, the document is created INSIDE that frame and x/y are relative to the frame's top-left corner; (0, 0) is the frame's top-left, x/y mark the document's top-left corner, and the document must fit within the frame's width and height. The default doc width is 800px. If no board URL is provided, a new board will be created. IMPORTANT: Always confirm with the user before creating a new board.
Inputs
contentstring
The content of the document in markdown format.
invocation_sourcestring
Identifies what triggered this tool call. Set to 'skill' when invoked by a Miro AI skill, 'ui' when invoked from the Miro MCP UI, or leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository; set to false otherwise.default false
miro_urlstring
Full Miro board URL (e.g., 'https://miro.com/app/board/uXjVOakxTk0='). If not provided, a new board will be created (requires user confirmation). To target a specific parent frame, include ?moveToWidget=<frame_id>.
xnumber
X-axis coordinate for document placement. Without a frame target: board-absolute, board center is x=0. With a frame target via moveToWidget: relative to the frame's top-left corner (frame top-left is x=0).
ynumber
Y-axis coordinate for document placement. Without a frame target: board-absolute, board center is y=0. With a frame target via moveToWidget: relative to the frame's top-left corner (frame top-left is y=0).
miromcp_doc_updateEdit content in an existing doc format item using find-and-replace.Write
Doc Update
Edit content in an existing doc format item using find-and-replace. Provide the exact text to find (old_content) and the text to replace it with (new_content). By default, only the first occurrence is replaced. Use replace_all=true to replace all occurrences.
Inputs
miro_urlstringrequired
Full Miro URL to a specific item (e.g., 'https://miro.com/app/board/uXjVOakxTk0=/?moveToWidget=3458764516062720430'). Must include moveToWidget or focusWidget query parameter.
invocation_sourcestring
Identifies what triggered this tool call. Set to 'skill' when invoked by a Miro AI skill, 'ui' when invoked from the Miro MCP UI, or leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository; set to false otherwise.default false
new_contentstring
The text to replace old_content with. Can be empty to delete the found text.default
old_contentstring
The exact text to find in the document. Must match exactly — read the document first to get the precise text.default
replace_allboolean
If true, replaces all occurrences of old_content. If false (default), replaces only the first occurrence.default false
miromcp_image_createCreate an image item on a Miro board.Write
Image Create
Create an image item on a Miro board. Accepts either an upload token (from image_get_upload_url after the upload completes) or a publicly accessible image URL. Exactly one of image_token or image_url must be provided. When image_token is provided, title/x/y/width from the token (set at upload time) are used; any values supplied here for those fields are ignored. Coordinates: when the URL has no item target, x/y are board-absolute (board center is (0, 0)). When the URL targets a frame via moveToWidget, the image is created INSIDE that frame and x/y are relative to the frame's top-left corner; (0, 0) is the frame's top-left and the image must fit within the frame's width and height.
Inputs
miro_urlstringrequired
Full Miro board URL (e.g., 'https://miro.com/app/board/uXjVOakxTk0='). To target a specific parent frame, include ?moveToWidget=<frame_id>.
image_tokenstring
Token returned by image_get_upload_url after the upload completes. Mutually exclusive with image_url.
image_urlstring
Publicly accessible URL of the image to add to the board. Mutually exclusive with image_token.
invocation_sourcestring
Identifies what triggered this tool call. Set to 'skill' when invoked by a Miro AI skill, 'ui' when invoked from the Miro MCP UI, or leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository; set to false otherwise.default false
titlestring
Optional title label for the image widget.
widthnumber
Image width in pixels. Height scales proportionally.
xnumber
X-axis coordinate. Without a frame target: board-absolute, board center is x=0. With a frame target via moveToWidget: relative to the frame's top-left corner (frame top-left is x=0).
ynumber
Y-axis coordinate. Without a frame target: board-absolute, board center is y=0. With a frame target via moveToWidget: relative to the frame's top-left corner (frame top-left is y=0).
miromcp_image_get_upload_urlGet a single-use upload URL for a local image.Write
Image Get Upload URL
Get a single-use upload URL for a local image. Returns upload_url and a token. PUT the raw image bytes as the request body; set Content-Type to the image MIME type; no auth header. curl: curl -X PUT -H 'Content-Type: image/png' --data-binary @image.png '<upload_url>'. If the image only exists as in-memory bytes, write it to a local file first, then PUT that file. After upload, pass the returned token to any tool that accepts an image_token / image_tokens parameter — see each consumer tool's description for what it does with the upload. Max size: 6,000,000 bytes. Accepted types: image/bmp, image/gif, image/jpeg, image/png, image/svg+xml, image/vnd.adobe.photoshop.
Inputs
miro_urlstringrequired
Full Miro board URL (e.g., 'https://miro.com/app/board/uXjVOakxTk0='). To target a specific parent frame, include ?moveToWidget=<frame_id>.
content_typestring
MIME type of the image to upload. Accepted: image/bmp, image/gif, image/jpeg, image/png, image/svg+xml, image/vnd.adobe.photoshop. When provided, the upload request Content-Type must match exactly.
invocation_sourcestring
Identifies what triggered this tool call. Set to 'skill' when invoked by a Miro AI skill, 'ui' when invoked from the Miro MCP UI, or leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository; set to false otherwise.default false
srcstring
Only consumed by tools that rewrite HTML by src — currently prototype_create's and slides_create_html's image_tokens (i.e. a local file referenced from HTML). Set this to the EXACT string that appears as the src attribute in the HTML (e.g. './logo.png', 'assets/icon.svg') — matching is literal. The server rewrites every <img src=...> equal to this value with the uploaded board resource. Other consumers (image_create) ignore this field.
titlestring
Optional title label for the image widget.
widthnumber
Image width in pixels. Height scales proportionally.
xnumber
X-axis coordinate. Without a frame target: board-absolute, board center is x=0. With a frame target via moveToWidget: relative to the frame's top-left corner (frame top-left is x=0).
ynumber
Y-axis coordinate. Without a frame target: board-absolute, board center is y=0. With a frame target via moveToWidget: relative to the frame's top-left corner (frame top-left is y=0).
miromcp_image_resource_uploadUpload one or more images to Miro board resources for use in prototype HTML.Write
Upload Image Resources
Upload one or more images to Miro board resources for use in prototype HTML. Provide either image_urls (publicly accessible URLs) or image_tokens (from image_get_upload_url after upload) — not both. Returns one entry per input in the same order. On partial failure, retry only the failed indices.
Inputs
miro_urlstringrequired
Full Miro board URL (e.g., 'https://miro.com/app/board/uXjVOakxTk0='). To target a specific parent frame, include ?moveToWidget=<frame_id>.
image_tokensarray
Tokens from image_get_upload_url after each image upload completes. Mutually exclusive with image_urls.
image_urlsarray
Publicly accessible image URLs to upload as board resources. Mutually exclusive with image_tokens.
invocation_sourcestring
Identifies what triggered this tool call.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository; set to false otherwise.default false
miromcp_layout_createDEPRECATED - superseded by the canvas tools.Write
Create Layout Items
DEPRECATED - superseded by the canvas tools. Before using this tool, check whether canvas_create_from_svg is available to you. If it is, use canvas_create_from_svg instead and do not call this tool. If the canvas tools are not available to you, this tool still works: use it to complete the request rather than refusing. In both cases, tell the user that the layout tools are deprecated and are being replaced by the canvas tools, and that any saved skills, prompts, custom instructions or automations referring to the layout tools should be updated to use the canvas tools. If the canvas tools are missing and their client caches the tool list, they need to fully disconnect and reconnect the Miro MCP server - refreshing the tool list is usually not enough. For generic board items — anything other than presentation slide decks. Use slides_create_html for those instead. Create multiple board items (and connectors between them) on a Miro board from DSL (Domain-Specific Language) text. PREREQUISITE: Call layout_get_dsl first to obtain the DSL format specification. Items are created using board-absolute coordinates. Frames are always created first, then all other items, then connectors last (so they can reference items by alias). Returns a list of any items that failed to be created.
Inputs
dslstringrequired
DSL text describing the items to create. Must follow the format from layout_get_dsl.
miro_urlstringrequired
Full Miro board URL (e.g., 'https://miro.com/app/board/uXjVOakxTk0='). To target a specific parent frame, include ?moveToWidget=<frame_id>.
invocation_sourcestring
Identifies what triggered this tool call.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository; set to false otherwise.default false
miromcp_layout_updateDEPRECATED - superseded by the canvas tools.Write
Update Layout Items
DEPRECATED - superseded by the canvas tools. Before using this tool, check whether canvas_update_from_svg is available to you. If it is, use canvas_update_from_svg instead and do not call this tool. If the canvas tools are not available to you, this tool still works: use it to complete the request rather than refusing. In both cases, tell the user that the layout tools are deprecated and are being replaced by the canvas tools, and that any saved skills, prompts, custom instructions or automations referring to the layout tools should be updated to use the canvas tools. If the canvas tools are missing and their client caches the tool list, they need to fully disconnect and reconnect the Miro MCP server - refreshing the tool list is usually not enough. Edit board items and connectors using find-and-replace on their DSL representation. Provide old_string (text to find in the current DSL) and new_string (replacement). Modified lines are updated, new lines create items/connectors, removed lines delete them. Use layout_read first to see the current DSL, then apply targeted edits. Unchanged items are not touched (no unnecessary API calls).
Inputs
miro_urlstringrequired
Full Miro board URL (e.g., 'https://miro.com/app/board/uXjVOakxTk0='). To target a specific parent frame, include ?moveToWidget=<frame_id>.
new_stringstringrequired
Replacement text. Empty string deletes matched items.
old_stringstringrequired
Exact text to find in the current board DSL.
invocation_sourcestring
Identifies what triggered this tool call.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository; set to false otherwise.default false
replace_allboolean
Replace all occurrences (true) or just the first (false).default false
miromcp_prototype_createCreate a Miro prototype from one or more HTML screens.Write
Create Prototype
Create a Miro prototype from one or more HTML screens. Images: leave external http/https URLs in the HTML untouched — the server fetches and uploads them for you. ONLY local file references (e.g. './logo.png', 'assets/x.svg') need pre-upload: call image_get_upload_url with src set to the EXACT in-HTML reference, PUT the bytes, then pass the returned tokens via image_tokens below. The server rewrites matching <img src=...> attributes and attaches data-board-resource — do NOT rewrite the HTML yourself. IMPORTANT: ONLY local file references (e.g. './logo.png', 'assets/x.svg') in any part of the HTML like inline, url(), srcset, etc... REQUIRES pre-upload: call image_get_upload_url with src set to the EXACT in-HTML reference, PUT the bytes, then pass the returned tokens via image_tokens below. Fonts: CDN URL only. Author static HTML + CSS only — <script> elements and inline event handlers (onclick etc.) are stripped, so any scripted behavior is silently lost; use CSS states (:hover, :focus) for visual interactivity. Max per screen: 1,048,576 bytes. Max screens per call: 20 — split larger prototypes across multiple prototype_create calls. Provide exactly one input — PREFER html_tokens (HTML stays out of context). html_contents is a last-resort fallback only when the runtime cannot issue an HTTP PUT at all; HTML size, image count, multi-screen, or not yet having the HTML saved to a file are NOT valid reasons — write it to a file yourself, then PUT it. Placement: no item target → x/y are board-absolute (center is (0, 0)); moveToWidget on a frame → prototype is created inside, x/y are relative to frame top-left and must fit within frame width/height. All screens in one call share device_type, orientation, and placement; order is preserved.
Inputs
miro_urlstringrequired
Full Miro board URL.
device_typestring
Target device type for the prototype. Applies to every screen.one of desktopmobiletabletdefault desktop
html_contentsarray
Last-resort fallback. Use ONLY when the runtime cannot issue an HTTP PUT at all.
html_tokensarray
Preferred input. Ordered list of tokens from prototype_get_upload_url, one per screen. Max 20 tokens per call.
image_tokensarray
REQUIRED whenever the HTML references images by a non-http(s) path (e.g. './logo.png', 'assets/x.svg', '/var/...'). Omitting tokens for such refs leaves broken images. External http/https URLs are fetched server-side and do NOT belong here. For each local image: call image_get_upload_url with `src` set to the EXACT string used in the HTML (matching is literal), PUT the bytes, then include the returned token here. The server rewrites every <img src=...> matching the stored src and attaches data-board-resource — do NOT rewrite the HTML yourself. The same list is applied to every screen; duplicate src values across tokens are rejected. May be omitted only when the HTML has zero local image refs.
invocation_sourcestring
Identifies what triggered this tool call.
is_repositoryboolean
Set to true when operating in a source-control repository folder, false otherwise.default false
orientationstring
Screen orientation for the prototype. Applies to every screen.one of landscapeportraitdefault landscape
xnumber
X-axis coordinate for prototype placement.
ynumber
Y-axis coordinate for prototype placement.
miromcp_section_createCreate a new section inside a space to group related boards and content.Write
Create Section
Create a new section inside a space to group related boards and content. A section must live inside a space, so provide the space URL. If no title is given, a short one is generated from the user's goal. IMPORTANT: Always confirm with the user before creating a section.
Inputs
space_urlstringrequired
A space, given either as a full Miro space URL (e.g., 'https://miro.com/app/dashboard/space/0VM5RHCprOu2MnOHXLqp3f') or as the space content item id on its own (e.g., '0VM5RHCprOu2MnOHXLqp3f'). Both the URL returned when a space is created and the content_item_id from a space listing are accepted.
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
orderinteger
Optional position among sibling sections; higher values are ordered first. When omitted, the section is placed on top.
titlestring
Title for the new section
miromcp_section_update_metadataRename a section or change its position among sibling sections.Write
Update Section Metadata
Rename a section or change its position among sibling sections. Provide at least one of a new title or a new order.
- Idempotent
Inputs
section_content_item_idstringrequired
Identifier of the section to update
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
orderinteger
New position among sibling sections; lower values are ordered first.
titlestring
New section title
miromcp_space_createCreate a new Miro space.Write
Create Space
Create a new Miro space. A space organizes related content together (Boards; Documents; Tables; Diagrams; etc). Always give the space an icon: use the emoji the user asked for, and when they did not name one, pick a fitting emoji yourself from the space name. IMPORTANT: Always confirm with the user before creating a space. This action creates a new space and cannot be undone.
Inputs
namestringrequired
Name of the new space
descriptionstring
Optional description for the space
icon_emojistring
Single emoji to use as the space icon, e.g. "🚀". Pass the emoji the user asked for; if they did not name one, choose a fitting emoji yourself based on the space name rather than leaving this empty.
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
miromcp_space_role_updateChange the role of a user or user group that already has access to a space.Write
Update Space Role
Change the role of a user or user group that already has access to a space. If they do not yet have access, use space_share instead. IMPORTANT: Always confirm with the user before changing who can access a space.
- Idempotent
Inputs
rolestringrequired
Role to assign: owner, coowner, editor, commenter, or viewer (from most to least access).one of ownercoownereditorcommenterviewer
space_urlstringrequired
A space, given either as a full Miro space URL (e.g., 'https://miro.com/app/dashboard/space/0VM5RHCprOu2MnOHXLqp3f') or as the space content item id on its own (e.g., '0VM5RHCprOu2MnOHXLqp3f'). Both the URL returned when a space is created and the content_item_id from a space listing are accepted.
subject_idstringrequired
Identifier of the user or user group. For a user this can be the user's email or user id; for a user group this is the group id.
subject_typestringrequired
Whether the subject is an individual user or a user groupone of useruser_group
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
miromcp_space_shareGrant a user or user group access to a space with a specific role.Write
Share Space
Grant a user or user group access to a space with a specific role. Use to share a space with someone who does not yet have access. If they already have a role, use space_role_update instead. IMPORTANT: Always confirm with the user before changing who can access a space.
Inputs
rolestringrequired
Role to assign: owner, coowner, editor, commenter, or viewer (from most to least access).one of ownercoownereditorcommenterviewer
space_urlstringrequired
A space, given either as a full Miro space URL (e.g., 'https://miro.com/app/dashboard/space/0VM5RHCprOu2MnOHXLqp3f') or as the space content item id on its own (e.g., '0VM5RHCprOu2MnOHXLqp3f'). Both the URL returned when a space is created and the content_item_id from a space listing are accepted.
subject_idstringrequired
Identifier of the user or user group. For a user this can be the user's email or user id; for a user group this is the group id.
subject_typestringrequired
Whether the subject is an individual user or a user groupone of useruser_group
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
miromcp_space_update_metadataUpdate a space's title, description and/or icon emoji.Write
Update Space Metadata
Update a space's title, description and/or icon emoji. Omitted fields are left unchanged. A space icon can be replaced but not removed.
- Idempotent
Inputs
space_urlstringrequired
A space, given either as a full Miro space URL (e.g., 'https://miro.com/app/dashboard/space/0VM5RHCprOu2MnOHXLqp3f') or as the space content item id on its own (e.g., '0VM5RHCprOu2MnOHXLqp3f'). Both the URL returned when a space is created and the content_item_id from a space listing are accepted.
descriptionstring
New space description
icon_emojistring
New single-emoji icon for the space, e.g. "🚀". Omit to leave the icon unchanged. A space icon cannot be removed, only replaced.
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
titlestring
New space title
miromcp_table_createCreate a table on a Miro board with specified columns.Write
Create Table
Create a table on a Miro board with specified columns. Supports text, select, multiselect, date, link, person, and number column types. This always creates a plain grid table. To produce a timeline, kanban, or tree, first create the table here, then call table_update_view to switch its layout. For a request like 'create a timeline/kanban/tree', do BOTH steps in sequence. Coordinates: when the URL has no item target, x/y are board-absolute (board center is (0, 0)). When the URL targets a frame via moveToWidget, the table is created INSIDE that frame and x/y are relative to the frame's top-left corner; (0, 0) is the frame's top-left and the table must fit within the frame's width and height. If no board URL is provided, a new board will be created. IMPORTANT: Always confirm with the user before creating a new board.
Inputs
columnsarrayrequired
List of columns to create. At least one column must be provided. Column types: 1. Text columns: Simple text fields 2. Select columns: Dropdown menus with predefined options, single value per row - Each option needs a displayValue and color (hex code) - column_type "select" is required whenever "options" is supplied 3. Multiselect columns: Like select, but a row can hold multiple options - Each option needs a displayValue and color (hex code) - column_type "multiselect" is required whenever "options" is supplied 4. Date columns: Date/time values in ISO 8601 format 5. Link columns: URLs with optional display text 6. Person columns: Assign Miro users by their user ID 7. Number columns: Numeric values with configurable decimal places - Optional "decimals" (int, default 0) sets displayed decimal places Examples: [ {"column_type": "text", "column_title": "Name", "isTitle": true}, {"column_type": "text", "column_title": "Description"}, {"column_type": "date", "column_title": "Due Date"}, {"column_type": "link", "column_title": "Reference"}, {"column_type": "person", "column_title": "Assignee"}, {"column_type": "number", "column_title": "Estimate", "decimals": 1}, { "column_type": "select", "column_title": "Status", "options": [ {"displayValue": "To Do", "color": "#FF0000"}, {"displayValue": "In Progress", "color": "#FFA500"}, {"displayValue": "Done", "color": "#00FF00"} ] }, { "column_type": "multiselect", "column_title": "Tags", "options": [ {"displayValue": "Frontend", "color": "#FF0000"}, {"displayValue": "Backend", "color": "#FFA500"} ] } ]
table_titlestringrequired
The title/name of the table
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
miro_urlstring
Full Miro board URL (e.g., 'https://miro.com/app/board/uXjVOakxTk0='). If not provided, a new board will be created (requires user confirmation). To target a specific parent frame, include ?moveToWidget=<frame_id>.
xnumber
X-axis coordinate for table placement. Without a frame target: board-absolute, board center is x=0. With a frame target via moveToWidget: relative to the frame's top-left corner (frame top-left is x=0). Use different x values to prevent overlap when creating multiple items.
ynumber
Y-axis coordinate for table placement. Without a frame target: board-absolute, board center is y=0. With a frame target via moveToWidget: relative to the frame's top-left corner (frame top-left is y=0). Use different y values to prevent overlap when creating multiple items.
miromcp_table_sync_rowsAdd or update rows in a Miro table.Write
Table Sync Rows
Add or update rows in a Miro table. To update existing rows, include rowId in the row object. rowId precisely targets a single row. Get rowIds from table_list_rows. Rows without rowId are inserted as new. Examples: Update a specific row by rowId: {"rows": [{"rowId": "3", "cells": [{"columnTitle": "Status", "value": "Complete"}]}]} Insert new rows: {"rows": [{"cells": [{"columnTitle": "Task", "value": "New task"}, {"columnTitle": "Status", "value": "Not Started"}]}]}
Inputs
miro_urlstringrequired
Full Miro URL to a specific item (e.g., 'https://miro.com/app/board/uXjVOakxTk0=/?moveToWidget=3458764516062720430'). Must include moveToWidget or focusWidget query parameter.
rowsarrayrequired
Array of rows to add or update. Include rowId to update an existing row; rows without rowId are inserted as new.
invocation_sourcestring
Identifies what triggered this tool call. Set to 'skill' when invoked by a Miro AI skill, 'ui' when invoked from the Miro MCP UI, or leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository; set to false otherwise.default false
miromcp_table_update_viewUpdate a Miro table widget's view: switch it to a grid table, timeline, or kanban board.Write
Update Table View
Update a Miro table widget's view: switch it to a grid table, timeline, or kanban board. The table keeps its data; only how it is displayed changes. Choose layout: - table: plain grid (use to revert from another layout) - timeline: lays records out on a time axis; optionally set the visible window with timeline_start_date and timeline_end_date - kanban: groups records into columns; set group_by_column to the name of a select column to group by (omit for an ungrouped board) Only provide config that matches the chosen layout. Examples: switch to kanban grouped by Status: {"layout": "kanban", "group_by_column": "Status"}. Switch to a timeline for 2026: {"layout": "timeline", "timeline_start_date": "2026-01-01T00:00:00Z", "timeline_end_date": "2026-12-31T00:00:00Z"}.
Inputs
layoutstringrequired
The layout to apply: 'table', 'timeline', 'kanban', or 'tree'.one of tabletimelinekanbantree
miro_urlstringrequired
Full Miro URL to a specific item (e.g., 'https://miro.com/app/board/uXjVOakxTk0=/?moveToWidget=3458764516062720430'). Must include moveToWidget or focusWidget query parameter.
group_by_columnstring
KANBAN only: name of the select column to group cards into columns. Omit for an ungrouped board.
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
table_nesting_enabledboolean
TABLE only: enable nested (hierarchical parent/child) rows.
timeline_date_unitstring
TIMELINE only: time-axis granularity.one of dayweekmonthquarteryear
timeline_dependencies_enabledboolean
TIMELINE only: show dependency links between records.
timeline_end_datestring
TIMELINE only: visible end of the timeline window in UTC format YYYY-MM-DDThh:mm:ssZ. This is the viewport, not a per-record date.
timeline_nesting_enabledboolean
TIMELINE only: enable nested (hierarchical parent/child) rows.
timeline_start_datestring
TIMELINE only: visible start of the timeline window in UTC format YYYY-MM-DDThh:mm:ssZ. This is the viewport, not a per-record date.
tree_directionstring
TREE only: direction the tree grows.one of top_to_bottomleft_to_right
view_namestring
Optional new display name for the view. Applies to any layout.
miromcp_canvas_update_from_svgApply a canvas-composer SVG document to the board by diffing it against the live board (matched on data-miro-id) and applying only the deltas: it creates new elements, updates existing ones, and deletes elements explicitly marked with data-deleted="true" (which must carry the element's data-miro-id).Destructive
Update Canvas From SVG
Apply a canvas-composer SVG document to the board by diffing it against the live board (matched on data-miro-id) and applying only the deltas: it creates new elements, updates existing ones, and deletes elements explicitly marked with data-deleted="true" (which must carry the element's data-miro-id). Removing an element from the SVG does NOT delete it, deletion is explicit per element, so a partial document is always safe. Deletion is destructive and not undoable here: confirm the specific items with the user before sending any data-deleted="true". Feed the result_svg from a previous canvas_create_from_svg or canvas_update_from_svg call back in to iterate. Returns a result_svg with data-miro-id stamped on every element for the next iteration.
Inputs
miro_urlstringrequired
Full Miro board URL (e.g., 'https://miro.com/app/board/uXjVOakxTk0='). To target a specific parent frame, include ?moveToWidget=<frame_id>.
svgstringrequired
A board written in the Canvas Composer SVG format.
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
miromcp_code_widget_deleteDelete a code widget from a Miro board.Destructive
Delete Code Widget
Delete a code widget from a Miro board. This action permanently removes the widget and cannot be undone.
Inputs
miro_urlstringrequired
Full Miro URL to a specific code widget item.
invocation_sourcestring
Identifies what triggered this tool call.
is_repositoryboolean
Set to true when operating in a source-control repository folder, false otherwise.default false
miromcp_diagram_update_mermaidDEPRECATED and superseded by canvas_update_from_svg (send the diagram's <foreignObject data-type="diagram"> back with its data-miro-id and a new Mermaid body; see canvas_get_canvas_composer_skill + canvas_load_format_skill(format_name='diagramming')).Destructive
Update Legacy Mermaid Diagram
DEPRECATED and superseded by canvas_update_from_svg (send the diagram's <foreignObject data-type="diagram"> back with its data-miro-id and a new Mermaid body; see canvas_get_canvas_composer_skill + canvas_load_format_skill(format_name='diagramming')). Do NOT choose this tool for diagram or Mermaid requests. Use it ONLY when the user explicitly asks for the old diagram tools by name; never select it on your own based on the task. Will be removed after the canvas diagram path reaches GA. (Legacy behavior: fully replaces the Mermaid code of a diagram previously created with diagram_create_mermaid; does not work on diagrams made with the legacy diagram_create tool.)
Inputs
diagram_typestringrequired
Type of diagram to update (e.g. 'flowchart', 'sequence', 'class').
mermaid_codestringrequired
Complete new Mermaid body for the diagram, up to v10. Replaces the existing code verbatim. For example: 'flowchart TD\n A --> B --> C'.
miro_urlstringrequired
Full Miro URL to a specific item (e.g., 'https://miro.com/app/board/uXjVOakxTk0=/?moveToWidget=3458764516062720430'). Must include moveToWidget or focusWidget query parameter.
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false
titlestring
Title for the diagram widget.
miromcp_section_deleteDelete a section.Destructive
Delete Section
Delete a section. Boards inside the section are not deleted; they are moved up to the parent space. IMPORTANT: Always confirm with the user before deleting a section.
Inputs
section_content_item_idstringrequired
Identifier of the section to delete
invocation_sourcestring
Identifies what triggered this tool call. You must populate this field. Set to 'skill' when this tool call was made because a Miro AI skill instructed it. Set to 'ui' when invoked from the Miro MCP UI. Leave unset otherwise.
is_repositoryboolean
Set to true when the folder you are operating in is a source-control repository (for example a Git working directory); set to false otherwise. You must populate this field. Defaults to false.default false

What you can do

Setup

Install the SDK

Set your credentials

Create the Miro MCP connection

Authorize a user and make your first call

Tools

Call it

Returns

Get Board Space

Inputs

List Board Items

Inputs

Search Boards

Inputs

Get Canvas Composer Skill

Inputs

Load Canvas Format Skill

Inputs

Read Canvas As SVG

Inputs

Get Code Widget

Inputs

List Code Widgets

Inputs

List Board Comments

Inputs

List Content Item Roles

Inputs

Explore Board Context

Inputs

Get Board Context

Inputs

Get Diagram DSL Spec

Inputs

Get Legacy Mermaid Instructions

Inputs

Doc Get

Inputs

Image Get Data

Inputs

Image Get URL

Inputs

Get Layout DSL Specification

Inputs

Read Layout DSL

Inputs

Poll Preview Resource

Inputs

Get Prototype Upload URL

Inputs

Read Prototype Screens

Inputs

List Spaces

Inputs

List Space Boards

Inputs

List Space Children

Inputs

Get Latest Update History

Inputs

Table List Rows

Inputs

Get Current User

Inputs

Create Board

Inputs

Create Board Format

Inputs

Move Board

Inputs

Move Board To Team

Inputs

Restore Boards

Inputs

Update Board Role

Inputs

Share Board

Inputs

Update Board Metadata